Protein Family IF01175
Metagenome
Isolate
134
Members
65
Samples
109
Scaffolds
128.5
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10007593|Ga0068305_1000759342
- Length
- 140 aa
- Sequence
- VLQRRAKISPNFSMASMTDVIFLLLIFFMITSTVVSPNAIKVLLPQGKQQTSAKPLTRVIIDKDLNFYAAFGNDKEQAISLEDLTPFLQSCATKEPEMYVALYADESVPYREIVKVLNIANENKFKMVLATRPPEGKGK*
Sample Types
Isolate
18.7%
Metagenome
81.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
34.4%
Termitidae
23.4%
Kalotermitidae
20.3%
Unclassified
7.8%
Rhinotermitidae
6.2%
Termopsidae
4.7%
Hodotermitidae
1.6%
Passalidae
1.6%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 2 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 3 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 6 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 7 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 19 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 27 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 28 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 29 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 30 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 41 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 47 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 48 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 49 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 50 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 51 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 54 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 55 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 59 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_250312 | 3300042619 | Bacteria | 3092 |
| 2 | Ga0466729_038665 | 3300042621 | Bacteria | 15259 |
| 3 | Ga0466696_308767 | 3300042596 | Bacteria | 1986 |
| 4 | Ga0466706_049476 | 3300042599 | Bacteria | 1598 |
| 5 | Ga0466707_382634 | 3300042601 | Bacteria | 1438 |
| 6 | Ga0466713_124643 | 3300042602 | Bacteria | 27149 |
| 7 | Ga0466714_019235 | 3300042603 | Bacteria | 13134 |
| 8 | IMNBL1DRAFT_c0178692 | 3300000062 | Bacteria | 537 |
| 9 | Ga0466697_080461 | 3300042611 | Bacteria | 2150 |
| 10 | Ga0466703_106609 | 3300042636 | Bacteria | 26708 |
| 11 | Ga0466704_005654 | 3300042643 | Bacteria | 10865 |
| 12 | Ga0123353_10196582 | 3300010167 | Bacteria | 3178 |
| 13 | Ga0123354_10181355 | 3300010882 | Bacteria | 2402 |
| 14 | Ga0466711_123869 | 3300042615 | Bacteria | 4016 |
| 15 | Ga0466711_283591 | 3300042615 | Bacteria | 3600 |
| 16 | Ga0466715_215776 | 3300042616 | Bacteria | 39785 |
| 17 | Ga0466657_075840 | 3300042582 | Bacteria | 1500 |
| 18 | Ga0466696_279300 | 3300042596 | Bacteria | 7394 |
| 19 | Ga0466706_004348 | 3300042599 | Bacteria | 1249 |
| 20 | Ga0466706_065713 | 3300042599 | Bacteria | 2116 |
| 21 | Ga0466706_094705 | 3300042599 | Bacteria | 26280 |
| 22 | Ga0466706_103812 | 3300042599 | Bacteria | 57157 |
| 23 | Ga0466706_128935 | 3300042599 | Bacteria | 12762 |
| 24 | Ga0466706_223958 | 3300042599 | Bacteria | 16784 |
| 25 | Ga0466700_275474 | 3300042600 | Bacteria | 4734 |
| 26 | Ga0466713_074382 | 3300042602 | Bacteria | 12079 |
| 27 | Ga0466722_141208 | 3300042609 | Bacteria | 7802 |
| 28 | JGI24699J35502_11129693 | 3300002509 | Bacteria | 4801 |
| 29 | Ga0466703_404590 | 3300042636 | Bacteria | 4602 |
| 30 | Ga0466725_344831 | 3300042654 | Bacteria | 5331 |
| 31 | Ga0123356_10099710 | 3300010049 | Bacteria | 2785 |
| 32 | Ga0466711_069500 | 3300042615 | Bacteria | 1238 |
| 33 | Ga0466715_218422 | 3300042616 | Bacteria | 20789 |
| 34 | Ga0466728_270400 | 3300042620 | Bacteria | 35265 |
| 35 | Ga0466706_016093 | 3300042599 | Bacteria | 1622 |
| 36 | Ga0466706_031709 | 3300042599 | Bacteria | 16740 |
| 37 | Ga0466706_060433 | 3300042599 | Bacteria | 6838 |
| 38 | Ga0466707_104585 | 3300042601 | Bacteria | 1560 |
| 39 | Ga0466713_034758 | 3300042602 | Bacteria | 23612 |
| 40 | Ga0466713_070449 | 3300042602 | Bacteria | 62168 |
| 41 | Ga0466714_022616 | 3300042603 | Bacteria | 55137 |
| 42 | Ga0466722_249159 | 3300042609 | Bacteria | 79748 |
| 43 | IMNBL1DRAFT_c0002121 | 3300000062 | Bacteria | 14121 |
| 44 | Ga0068305_10180264 | 3300005083 | Bacteria | 1637 |
| 45 | Ga0068305_10394913 | 3300005083 | Bacteria | 1460 |
| 46 | Ga0466735_173583 | 3300042624 | Bacteria | 1861 |
| 47 | Ga0466708_071605 | 3300042652 | Bacteria | 10063 |
| 48 | Ga0466727_221985 | 3300042655 | Bacteria | 7289 |
| 49 | Ga0123357_10047594 | 3300009784 | Bacteria | 5811 |
| 50 | Ga0123356_10433612 | 3300010049 | Bacteria | 1459 |
| 51 | Ga0466711_203198 | 3300042615 | Bacteria | 14642 |
| 52 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 53 | Ga0466696_016009 | 3300042596 | Bacteria | 8497 |
| 54 | Ga0466701_028239 | 3300042598 | Bacteria | 3468 |
| 55 | Ga0466706_144964 | 3300042599 | Bacteria | 38907 |
| 56 | Ga0466716_345265 | 3300042605 | Bacteria | 9860 |
| 57 | Ga0466735_210592 | 3300042624 | Bacteria | 2076 |
| 58 | Ga0466703_005062 | 3300042636 | Bacteria | 5633 |
| 59 | Ga0466727_169454 | 3300042655 | Bacteria | 8118 |
| 60 | Ga0123356_11130469 | 3300010049 | Bacteria | 951 |
| 61 | Ga0123356_11865421 | 3300010049 | Bacteria | 748 |
| 62 | Ga0123353_10478045 | 3300010167 | Bacteria | 1824 |
| 63 | Ga0466723_051189 | 3300042618 | Unclassified | 6414 |
| 64 | Ga0466690_038157 | 3300042590 | Bacteria | 30366 |
| 65 | Ga0466713_009840 | 3300042602 | Unclassified | 6976 |
| 66 | Ga0466722_064137 | 3300042609 | Bacteria | 4217 |
| 67 | Ga0068305_10072648 | 3300005083 | Bacteria | 7795 |
| 68 | Ga0466735_054840 | 3300042624 | Bacteria | 1890 |
| 69 | Ga0466735_208566 | 3300042624 | Bacteria | 1077 |
| 70 | Ga0466708_050839 | 3300042652 | Bacteria | 8235 |
| 71 | Ga0123354_10227703 | 3300010882 | Bacteria | 1959 |
| 72 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 73 | Ga0466711_089277 | 3300042615 | Bacteria | 5866 |
| 74 | Ga0466728_282666 | 3300042620 | Bacteria | 52404 |
| 75 | Ga0466694_244296 | 3300042594 | Bacteria | 1601 |
| 76 | Ga0466696_008322 | 3300042596 | Bacteria | 7084 |
| 77 | Ga0466706_105640 | 3300042599 | Bacteria | 39915 |
| 78 | Ga0466714_070885 | 3300042603 | Bacteria | 12201 |
| 79 | Ga0466716_065855 | 3300042605 | Bacteria | 1039 |
| 80 | Ga0466716_260158 | 3300042605 | Bacteria | 8439 |
| 81 | Ga0466719_223626 | 3300042606 | Bacteria | 7314 |
| 82 | IMNBL1DRAFT_c0011393 | 3300000062 | Bacteria | 4155 |
| 83 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 84 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 85 | Ga0123356_10707948 | 3300010049 | Bacteria | 1176 |
| 86 | Ga0123354_10247805 | 3300010882 | Bacteria | 1813 |
| 87 | Ga0466715_256668 | 3300042616 | Bacteria | 4911 |
| 88 | Ga0415639_187098 | 3300038395 | Bacteria | 1590 |
| 89 | Ga0466701_029695 | 3300042598 | Bacteria | 16457 |
| 90 | Ga0466716_089579 | 3300042605 | Bacteria | 21981 |
| 91 | Ga0466716_383677 | 3300042605 | Bacteria | 4060 |
| 92 | Ga0466735_030183 | 3300042624 | Bacteria | 11567 |
| 93 | Ga0466703_019883 | 3300042636 | Bacteria | 23097 |
| 94 | Ga0466703_097689 | 3300042636 | Bacteria | 37276 |
| 95 | Ga0466704_192304 | 3300042643 | Bacteria | 4511 |
| 96 | Ga0123354_10000740 | 3300010882 | Bacteria | 35242 |
| 97 | Ga0466711_225462 | 3300042615 | Bacteria | 1236 |
| 98 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 99 | Ga0265387_1001732 | 3300024582 | Bacteria | 3131 |
| 100 | Ga0466690_034048 | 3300042590 | Bacteria | 5383 |
| 101 | Ga0466691_070237 | 3300042593 | Bacteria | 13056 |
| 102 | Ga0466700_402810 | 3300042600 | Bacteria | 14043 |
| 103 | JGI24702J35022_10433701 | 3300002462 | Bacteria | 798 |
| 104 | JGI24699J35502_10982398 | 3300002509 | Bacteria | 1277 |
| 105 | JGI24699J35502_11133694 | 3300002509 | Bacteria | 13722 |
| 106 | Ga0068305_10177511 | 3300005083 | Bacteria | 10537 |
| 107 | Ga0068305_11009815 | 3300005083 | Bacteria | 630 |
| 108 | Ga0466704_058087 | 3300042643 | Bacteria | 24952 |
| 109 | Ga0123357_10083087 | 3300009784 | Unclassified | 4204 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 10 | 132 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.