Protein Family IF00973

Metagenome Isolate
221 Members
149 Samples
121 Scaffolds
286.53 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10011331|CVPL010W_100113317
Length
315 aa
Sequence
VPLRWDQASAQDTVNQISHPHPAMGAGSQHLFMELILEPFHYHYMQTAIWVCALVGAVCAFLSAYLMLKGWSLIGDALSHSIVPGVAGAWMLGLPFSLGAFAAGGLAASTMLFLRQRTRLREDVVIGLIFTSFFGLGLFMVSLSPMPINVNTIIMGNVLAITREDTVQLALIGVVSLALLMWKWRDLLAVFFDEQHAQSIGLNPFRLKLLFFALLSACTVAAMMTVGAFLVIAMVVTPGATAYLLSDRFLRLLAISVAIGAGSGALGAFISYFLDGATGGIIVLLQTALFLLAFFFSPSHGRLAARWRMRRAAP*

📊 Sample Types

Isolate 45.2%
Metagenome 54.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.6%
Formicidae 16.7%
Apidae 11.8%
Drosophilidae 6.9%
Anthocoridae 6.2%
Curculionidae 4.9%
Termitidae 2.8%
Armadillidiidae 2.8%
Culicidae 2.8%
Tenebrionidae 2.1%
Talitridae 2.1%
Tephritidae 2.1%
Aphididae 1.4%
Nephropidae 1.4%
Pentatomidae 1.4%
Sarcophagidae 1.4%
Calliphoridae 1.4%
Pteromalidae 1.4%
Lysianassidae 0.7%
Daphniidae 0.7%
Thripidae 0.7%
Rhopalidae 0.7%
Carabidae 0.7%
Plutellidae 0.7%
Crambidae 0.7%
Cerambycidae 0.7%
Elmidae 0.7%
Muscidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 40

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
2 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
3 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
4 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
5 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
6 2751185856 Bartonella apis BBC0244 Isolate Apidae
7 648276708 Pantoea sp. aB Isolate Unclassified
8 8073617375 Bartonella apis W8098 Isolate Apidae
9 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
10 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
11 3300005319 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut Metagenome Drosophilidae
12 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
13 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
14 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
15 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
16 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
17 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
18 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
19 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
20 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
21 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
22 2556921669 Shinella sp. DD12 Isolate Daphniidae
23 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
24 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
25 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
26 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
27 8068946563 Bartonella apihabitans M0187 Isolate Apidae
28 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
29 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
30 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
31 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
32 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
33 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
34 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
35 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
36 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
37 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
38 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
39 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
42 8073624232 Bartonella sp. W8151 Isolate Apidae
43 8102982778 Erwinia sp. S63 Isolate Curculionidae
44 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
45 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
46 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
47 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
48 2585428048 Colwellia sp. NBT2012 Isolate
49 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
50 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
51 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
52 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
53 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
54 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
55 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
56 8068953321 Bartonella apihabitans M0190 Isolate Apidae
57 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
58 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
59 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
60 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
61 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
62 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
63 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
64 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
65 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
66 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
67 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
68 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
69 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
70 2751185853 Bartonella apis BBC0178 Isolate Apidae
71 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
72 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
73 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
74 8068944069 Bartonella choladocola W8125 Isolate Apidae
75 8068955631 Bartonella apihabitans M0280 Isolate Apidae
76 8073628750 Bartonella sp. W8167 Isolate Apidae
77 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
78 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
79 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
80 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
81 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
82 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
83 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
84 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
85 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
86 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
87 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
88 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
89 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
90 2585427605 Colwellia sp. MT2012 Isolate
91 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
92 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
93 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
94 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
95 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
96 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
97 8018312681 Enterobacter sp. OLF Isolate Tephritidae
98 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
99 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
100 8073626464 Bartonella apis W8152 Isolate Apidae
101 8099192374 Erwinia typographi IC4 Isolate Curculionidae
102 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
103 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
104 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
105 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
106 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
107 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
108 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
109 2836714267 Shimwellia blattae NCTC10965 Isolate
110 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
111 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
112 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
113 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
114 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
115 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
116 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
117 2603880170 Burkholderiales A2 Isolate Unclassified
118 2751185858 Bartonella apis BBC0122 Isolate Apidae
119 8021546568 Klebsiella sp. Kps Isolate Tephritidae
120 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
121 8073619611 Bartonella apis B10834G6 Isolate Apidae
122 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
123 8103002986 Erwinia sp. S38 Isolate Curculionidae
124 8103008710 Erwinia sp. S43 Isolate Curculionidae
125 2971189173 Yersinia pestis A-1249 Isolate Unclassified
126 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
127 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
128 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
129 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
130 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
131 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
132 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
133 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
134 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
135 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
136 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
137 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
138 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
139 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
140 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
141 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
142 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
143 8068950955 Bartonella apihabitans W8097 Isolate Apidae
144 8073621894 Bartonella apis W8099 Isolate Apidae
145 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
146 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
147 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
148 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
149 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160455_100873 3300012837 Bacteria 11464
2 Ga0160460_100353 3300012845 Bacteria 31451
3 Ga0160433_101796 3300012846 Unclassified 5328
4 Ga0466730_015559 3300042625 Bacteria 12801
5 Ga0466701_040221 3300042598 Bacteria 71565
6 Ga0466701_091420 3300042598 Bacteria 3300
7 Ga0466713_034072 3300042602 Bacteria 82126
8 Ga0466713_087423 3300042602 Unclassified 7667
9 CVPL010W_10001544 3300002931 Bacteria 27192
10 Ga0074302_1024015 3300005316 Bacteria 2670
11 Ga0102736_1000659 3300007052 Unclassified 7303
12 Ga0102736_1003705 3300007052 Bacteria 2162
13 Ga0103261_1002658 3300007083 Unclassified 2806
14 Ga0104041_1110265 3300007106 Unclassified 3144
15 Ga0102738_1000371 3300007141 Unclassified 7872
16 Ga0103264_1003128 3300007188 Bacteria 10408
17 Ga0160468_105167 3300012819 Bacteria 1505
18 Ga0316159_10081 3300030930 Bacteria 19428
19 Ga0466724_19220 3300042649 Unclassified 15959
20 Ga0466724_47083 3300042649 Bacteria 378486
21 Ga0160471_100129 3300012812 Bacteria 30780
22 DPOL_contig00004 2035918003 Bacteria 74609
23 CVPL010W_10000308 3300002931 Bacteria 47673
24 CVPL010W_10002473 3300002931 Bacteria 22039
25 Ga0063521_1000588 3300003973 Bacteria 15372
26 Ga0063521_1000782 3300003973 Unclassified 11474
27 Ga0074304_1034497 3300005319 Unclassified 2793
28 Ga0102736_1000023 3300007052 Bacteria 70447
29 Ga0103261_1002360 3300007083 Bacteria 2963
30 Ga0103261_1007994 3300007083 Unclassified 1501
31 Ga0102739_1013182 3300007095 Bacteria 1065
32 Ga0102734_1000259 3300007129 Bacteria 16478
33 Ga0102734_1000524 3300007129 Bacteria 27056
34 Ga0102738_1011482 3300007141 Bacteria 1216
35 Ga0102737_1003484 3300007142 Bacteria 3582
36 CVPL010W_10000310 3300002931 Bacteria 47641
37 CVPL005L_10006291 3300002938 Unclassified 12760
38 Ga0104041_1001673 3300007106 Bacteria 13613
39 Ga0103260_1000378 3300007139 Bacteria 11064
40 Ga0102737_1000013 3300007142 Bacteria 54146
41 Ga0103264_1000568 3300007188 Unclassified 18212
42 Ga0104147_1013471 3300007224 Bacteria 22083
43 Ga0160448_106834 3300012854 Bacteria 2799
44 Ga0316159_10453 3300030930 Unclassified 6388
45 Ga0247289_0139 3300035363 Unclassified 18899
46 Ga0466657_216185 3300042582 Bacteria 22362
47 FGTW_contig13745 2065487013 Bacteria 27070
48 CVPL010W_10000416 3300002931 Bacteria 44245
49 CVPL010L_1000020 3300002932 Bacteria 56498
50 CVPL005W_1000298 3300002934 Bacteria 41676
51 Ga0103266_1000067 3300007067 Bacteria 40296
52 Ga0102735_1000090 3300007080 Bacteria 37625
53 Ga0102739_1000270 3300007095 Bacteria 12300
54 Ga0102734_1001187 3300007129 Bacteria 8121
55 Ga0102737_1007154 3300007142 Unclassified 2057
56 Ga0103264_1000294 3300007188 Bacteria 27491
57 Ga0103264_1011929 3300007188 Unclassified 4258
58 Ga0103268_1001147 3300007192 Bacteria 17672
59 Ga0127656_100526 3300009453 Bacteria 33170
60 Ga0255572_1000003 3300026175 Bacteria 262489
61 Ga0247289_0148 3300035363 Unclassified 17928
62 Ga0466724_29344 3300042649 Unclassified 10292
63 FGTW_contig20739 2065487013 Unclassified 1440
64 CVPL005W_1000053 3300002934 Bacteria 43713
65 CVPL005W_1002750 3300002934 Unclassified 3230
66 Ga0063521_1000253 3300003973 Bacteria 35555
67 Ga0074278_123997 3300005721 Bacteria 11946
68 Ga0103263_100010 3300007042 Bacteria 58538
69 Ga0102736_1000668 3300007052 Unclassified 6624
70 Ga0102736_1001476 3300007052 Bacteria 4125
71 Ga0103261_1000510 3300007083 Unclassified 6341
72 Ga0102739_1005546 3300007095 Unclassified 1721
73 Ga0104041_1110212 3300007106 Unclassified 3341
74 Ga0102734_1028000 3300007129 Bacteria 1969
75 Ga0102740_1000625 3300007140 Unclassified 9659
76 Ga0102740_1008740 3300007140 Unclassified 1656
77 Ga0160444_100017 3300012841 Bacteria 336790
78 Ga0309902_000001 3300028910 Bacteria 348555
79 Ga0309903_100004 3300029809 Bacteria 108343
80 Ga0309904_1000017 3300029810 Bacteria 25067
81 Ga0466701_001909 3300042598 Bacteria 24724
82 Ga0466730_035437 3300042625 Unclassified 24782
83 Ga0466713_073462 3300042602 Bacteria 5818
84 CVPL010W_10000148 3300002931 Bacteria 57471
85 CVPL010L_1000466 3300002932 Unclassified 8915
86 Ga0063521_1000033 3300003973 Bacteria 118552
87 Ga0103260_1000011 3300007139 Bacteria 101836
88 Ga0103260_1005860 3300007139 Bacteria 1790
89 Ga0102740_1000001 3300007140 Bacteria 144366
90 Ga0102740_1014350 3300007140 Unclassified 1222
91 Ga0102737_1000683 3300007142 Bacteria 10788
92 Ga0102737_1002406 3300007142 Unclassified 4655
93 Ga0105005_1283228 3300007505 Unclassified 1764
94 Ga0309901_1000016 3300028918 Bacteria 176007
95 Ga0316159_10001 3300030930 Bacteria 1642808
96 Ga0466730_063581 3300042625 Unclassified 8787
97 Ga0466724_17050 3300042649 Unclassified 1434
98 CVPL010W_10000599 3300002931 Bacteria 39468
99 CVPL005W_1001322 3300002934 Bacteria 6738
100 Ga0063521_1000004 3300003973 Bacteria 302382
101 Ga0103266_1011815 3300007067 Unclassified 1041
102 Ga0102735_1001219 3300007080 Bacteria 4504
103 Ga0103261_1000066 3300007083 Bacteria 33889
104 Ga0102734_1020940 3300007129 Unclassified 2169
105 Ga0102737_1000520 3300007142 Unclassified 12571
106 Ga0104040_1142877 3300007149 Bacteria 2340
107 Ga0103264_1000030 3300007188 Bacteria 85624
108 Ga0103264_1000055 3300007188 Bacteria 65906
109 Ga0103267_1000011 3300007190 Bacteria 88011
110 Ga0105553_1034052 3300007767 Unclassified 6641
111 CVPL010W_10011331 3300002931 Bacteria 7956
112 CVPL010W_10017285 3300002931 Unclassified 4721
113 CVPL005W_1000207 3300002934 Unclassified 26220
114 Ga0063521_1000071 3300003973 Bacteria 83397
115 Ga0074278_104217 3300005721 Unclassified 4239
116 Ga0102738_1000059 3300007141 Bacteria 45781
117 Ga0102737_1007959 3300007142 Bacteria 1900
118 Ga0103264_1000016 3300007188 Bacteria 116870
119 Ga0103264_1000138 3300007188 Bacteria 73886
120 Ga0103264_1000793 3300007188 Bacteria 14537
121 Ga0103268_1005315 3300007192 Bacteria 2611

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00950 ABC-3 ABC 3 transport family 42 296 0.99
PF01032 FecCD FecCD transport family 85 293 0.79

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.