Protein Family IF00954
Metagenome
Isolate
170
Members
94
Samples
112
Scaffolds
262.77
Avg Length
Representative Sequence
- ID
- 3300002931|CVPL010W_10001028|CVPL010W_1000102811
- Length
- 295 aa
- Sequence
- MTGMDMRTAAPPQGAKAPSADSAAGQAAQPGGIPFALQCTDVRKTFDGGLPGARPATDGVTLTISPGEFVVVIGGNGAGKSTLLNLIAGAVLPDHGSITLAGRDVTHLAPHRRAGLVTRVFQDPMIGTAAAMTIEENLALAERRGKPHRARPLLTSARRARYRDALHALGLGLEDRLSTRVSLLSGGQRQALSLLMAVVSEPQLLLLDEHTAALDPRTAQRVMDATLHAVAAHKLTTLMVTHNMRHAIATGNRLLMMDAGRIRLDVRDAEKAALTPEALVEQFNIDNDRMRLAH*
Sample Types
Isolate
34.1%
Metagenome
65.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.9%
Termitidae
20.4%
Blattidae
15.1%
Formicidae
8.6%
Kalotermitidae
6.5%
Termopsidae
4.3%
Passalidae
3.2%
Stratiomyidae
2.2%
Rhinotermitidae
2.2%
Hydrophilidae
2.2%
Libellulidae
1.1%
Ceratopogonidae
1.1%
Vespidae
1.1%
Hodotermitidae
1.1%
Armadillidiidae
1.1%
Dytiscidae
1.1%
Scarabaeidae
1.1%
Pyrrhocoridae
1.1%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 2 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 3 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 4 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 9 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 10 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 11 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 12 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 13 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 14 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 15 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 16 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 25 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 26 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 27 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 28 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 33 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 34 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 35 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 36 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 37 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 38 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 39 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 40 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 41 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 48 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 49 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 54 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 55 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 58 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 61 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 62 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 63 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 65 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 66 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 67 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 68 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 69 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 70 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 71 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 72 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 73 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 74 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 75 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 76 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 77 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 78 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 79 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 80 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 81 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 82 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 83 | 2820940989 | Unclassified Actinobacteria Emb289P1bin20 | Isolate | Unclassified |
| 84 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 85 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 86 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 87 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 88 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 89 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 90 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 91 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 92 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 93 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 94 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10074984 | 3300009826 | Unclassified | 5417 |
| 2 | Ga0123353_10187863 | 3300010167 | Bacteria | 3265 |
| 3 | Ga0123353_11060548 | 3300010167 | Bacteria | 1081 |
| 4 | Ga0466706_231091 | 3300042599 | Unclassified | 2665 |
| 5 | Ga0466713_038929 | 3300042602 | Bacteria | 3702 |
| 6 | Ga0466713_067268 | 3300042602 | Bacteria | 78584 |
| 7 | Ga0466722_151666 | 3300042609 | Bacteria | 4382 |
| 8 | Ga0466725_267115 | 3300042654 | Bacteria | 1067 |
| 9 | Ga0466715_031756 | 3300042616 | Bacteria | 47286 |
| 10 | Ga0466715_552182 | 3300042616 | Bacteria | 4534 |
| 11 | Ga0466723_015328 | 3300042618 | Bacteria | 8700 |
| 12 | Ga0466723_315478 | 3300042618 | Bacteria | 2305 |
| 13 | Ga0415639_033821 | 3300038395 | Bacteria | 4471 |
| 14 | IMNBL1DRAFT_c0000163 | 3300000062 | Bacteria | 59088 |
| 15 | Ga0466733_222834 | 3300042659 | Bacteria | 2968 |
| 16 | Ga0123356_10004078 | 3300010049 | Bacteria | 15176 |
| 17 | Ga0123356_10071043 | 3300010049 | Bacteria | 3267 |
| 18 | Ga0123353_10106926 | 3300010167 | Bacteria | 4507 |
| 19 | Ga0123353_10478324 | 3300010167 | Bacteria | 1823 |
| 20 | Ga0466707_121593 | 3300042601 | Bacteria | 1393 |
| 21 | Ga0466719_055626 | 3300042606 | Bacteria | 3419 |
| 22 | Ga0466696_333768 | 3300042596 | Bacteria | 19814 |
| 23 | IMNBL1DRAFT_c0000008 | 3300000062 | Bacteria | 244959 |
| 24 | IMNBL1DRAFT_c0001200 | 3300000062 | Bacteria | 19626 |
| 25 | Ga0072940_1315738 | 3300005200 | Bacteria | 1133 |
| 26 | Ga0103268_1000275 | 3300007192 | Bacteria | 16926 |
| 27 | Ga0466697_135808 | 3300042611 | Bacteria | 4063 |
| 28 | Ga0466733_037464 | 3300042659 | Bacteria | 9749 |
| 29 | Ga0123357_10184851 | 3300009784 | Bacteria | 2421 |
| 30 | Ga0123355_10005323 | 3300009826 | Bacteria | 18809 |
| 31 | Ga0466706_153978 | 3300042599 | Unclassified | 2807 |
| 32 | Ga0466727_014447 | 3300042655 | Bacteria | 1736 |
| 33 | Ga0466715_045534 | 3300042616 | Bacteria | 2021 |
| 34 | Ga0466723_057032 | 3300042618 | Bacteria | 7164 |
| 35 | Ga0466726_311275 | 3300042619 | Bacteria | 2485 |
| 36 | Ga0160457_1018483 | 3300012858 | Bacteria | 979 |
| 37 | Ga0466693_286303 | 3300042592 | Bacteria | 2004 |
| 38 | 2227541309 | 2225789004 | Bacteria | 15551 |
| 39 | JGI24702J35022_10101384 | 3300002462 | Bacteria | 1576 |
| 40 | Ga0103266_1000005 | 3300007067 | Bacteria | 128947 |
| 41 | Ga0103267_1000277 | 3300007190 | Bacteria | 35660 |
| 42 | Ga0123357_10000425 | 3300009784 | Bacteria | 40381 |
| 43 | Ga0123357_10189462 | 3300009784 | Bacteria | 2375 |
| 44 | Ga0123355_10000813 | 3300009826 | Bacteria | 42746 |
| 45 | Ga0123355_10515933 | 3300009826 | Bacteria | 1465 |
| 46 | Ga0123356_10292866 | 3300010049 | Bacteria | 1729 |
| 47 | Ga0466706_285890 | 3300042599 | Bacteria | 2044 |
| 48 | Ga0466714_098602 | 3300042603 | Bacteria | 2113 |
| 49 | Ga0466719_123098 | 3300042606 | Bacteria | 142874 |
| 50 | Ga0466719_456917 | 3300042606 | Bacteria | 3521 |
| 51 | Ga0466724_25196 | 3300042649 | Bacteria | 102119 |
| 52 | Ga0466711_085577 | 3300042615 | Bacteria | 1700 |
| 53 | Ga0466711_274582 | 3300042615 | Bacteria | 1278 |
| 54 | Ga0466723_334651 | 3300042618 | Bacteria | 3078 |
| 55 | Ga0466729_054432 | 3300042621 | Bacteria | 18016 |
| 56 | Ga0466657_157131 | 3300042582 | Bacteria | 2119 |
| 57 | 2227480187 | 2225789004 | Bacteria | 78142 |
| 58 | IMNBL1DRAFT_c0007159 | 3300000062 | Bacteria | 5931 |
| 59 | Ga0103264_1001635 | 3300007188 | Bacteria | 10640 |
| 60 | Ga0123357_10005927 | 3300009784 | Bacteria | 14758 |
| 61 | Ga0123357_10234223 | 3300009784 | Bacteria | 2004 |
| 62 | Ga0123355_10194383 | 3300009826 | Bacteria | 2979 |
| 63 | Ga0123353_10770946 | 3300010167 | Bacteria | 1334 |
| 64 | Ga0123354_10027684 | 3300010882 | Bacteria | 8930 |
| 65 | Ga0466701_100639 | 3300042598 | Bacteria | 3141 |
| 66 | Ga0466735_022237 | 3300042624 | Bacteria | 3836 |
| 67 | Ga0466735_048575 | 3300042624 | Bacteria | 1570 |
| 68 | 2227072186 | 2225789003 | Bacteria | 2560 |
| 69 | 2227115554 | 2225789004 | Bacteria | 1723 |
| 70 | JGI24703J35330_11748066 | 3300002501 | Bacteria | 10346 |
| 71 | Ga0068302_10457066 | 3300005071 | Bacteria | 2468 |
| 72 | Ga0466733_020056 | 3300042659 | Bacteria | 1030 |
| 73 | Ga0123357_10049152 | 3300009784 | Bacteria | 5712 |
| 74 | Ga0123355_10010528 | 3300009826 | Bacteria | 14189 |
| 75 | Ga0466706_035905 | 3300042599 | Bacteria | 10172 |
| 76 | Ga0466719_195390 | 3300042606 | Bacteria | 8446 |
| 77 | Ga0255572_1000058 | 3300026175 | Bacteria | 107648 |
| 78 | 2227330769 | 2225789004 | Bacteria | 29043 |
| 79 | 2227507402 | 2225789004 | Bacteria | 3640 |
| 80 | IMNBL1DRAFT_c0002746 | 3300000062 | Bacteria | 11963 |
| 81 | CVPL010W_10001028 | 3300002931 | Bacteria | 31984 |
| 82 | Ga0123355_10001558 | 3300009826 | Bacteria | 32004 |
| 83 | Ga0123355_10014146 | 3300009826 | Bacteria | 12457 |
| 84 | Ga0123355_10052135 | 3300009826 | Bacteria | 6638 |
| 85 | Ga0123353_10913527 | 3300010167 | Bacteria | 1193 |
| 86 | Ga0123354_10000016 | 3300010882 | Bacteria | 143427 |
| 87 | Ga0123354_10026142 | 3300010882 | Bacteria | 9205 |
| 88 | Ga0466706_004781 | 3300042599 | Bacteria | 2338 |
| 89 | Ga0466704_147808 | 3300042643 | Bacteria | 1326 |
| 90 | Ga0466727_144312 | 3300042655 | Bacteria | 40021 |
| 91 | Ga0466727_335517 | 3300042655 | Bacteria | 3398 |
| 92 | Ga0466715_008074 | 3300042616 | Bacteria | 42016 |
| 93 | 2227308576 | 2225789004 | Bacteria | 6536 |
| 94 | IMNBL1DRAFT_c0001187 | 3300000062 | Bacteria | 19810 |
| 95 | IMNBL1DRAFT_c0005035 | 3300000062 | Bacteria | 7705 |
| 96 | Ga0103263_100136 | 3300007042 | Bacteria | 12716 |
| 97 | Ga0102739_1000513 | 3300007095 | Bacteria | 7759 |
| 98 | Ga0466733_176311 | 3300042659 | Bacteria | 1459 |
| 99 | Ga0123357_10009026 | 3300009784 | Bacteria | 12543 |
| 100 | Ga0123355_10217669 | 3300009826 | Bacteria | 2753 |
| 101 | Ga0123356_10043994 | 3300010049 | Bacteria | 4157 |
| 102 | Ga0123353_10632952 | 3300010167 | Bacteria | 1519 |
| 103 | Ga0466706_090661 | 3300042599 | Bacteria | 13437 |
| 104 | Ga0466706_275266 | 3300042599 | Bacteria | 2533 |
| 105 | Ga0466713_061714 | 3300042602 | Bacteria | 16984 |
| 106 | Ga0466729_206256 | 3300042621 | Bacteria | 13126 |
| 107 | Ga0466702_129129 | 3300042635 | Bacteria | 1421 |
| 108 | Ga0466724_37047 | 3300042649 | Bacteria | 249029 |
| 109 | Ga0466727_069449 | 3300042655 | Bacteria | 3472 |
| 110 | Ga0466711_071420 | 3300042615 | Bacteria | 2137 |
| 111 | 2227108611 | 2225789004 | Bacteria | 9454 |
| 112 | JGI24703J35330_11746861 | 3300002501 | Bacteria | 5751 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.