Protein Family IF00902
Metagenome
Isolate
121
Members
58
Samples
99
Scaffolds
141.35
Avg Length
Representative Sequence
- ID
- 3300002504|JGI24705J35276_12238693|JGI24705J35276_122386935
- Length
- 170 aa
- Sequence
- MKEASPYPPPKEGNXXXPLGEIEGVVNKKMNTITIKNLANIRLTAKEFIRQMDHRTVFAFHGIMGAGKTTFIKAICEELGVEDVINSPTFALINEYRSIESGELIYHFDFYRINKHSEAQDISVEDYFYSGALCFIEWPEKILPLLPDDTVHITIEEMENGMRELRIEN*
Sample Types
Isolate
18.2%
Metagenome
81.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Termitidae
19.3%
Kalotermitidae
19.3%
Unclassified
8.8%
Rhinotermitidae
7.0%
Passalidae
5.3%
Termopsidae
5.3%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 13 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 14 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 15 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 18 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 26 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 27 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 42 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 49 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 53 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_022093 | 3300042602 | Bacteria | 13281 |
| 2 | Ga0466719_084570 | 3300042606 | Bacteria | 7356 |
| 3 | Ga0466722_073583 | 3300042609 | Bacteria | 2346 |
| 4 | Ga0466696_052921 | 3300042596 | Bacteria | 29929 |
| 5 | Ga0466705_052187 | 3300042612 | Bacteria | 37548 |
| 6 | Ga0466703_008420 | 3300042636 | Bacteria | 9715 |
| 7 | Ga0466703_154899 | 3300042636 | Bacteria | 15748 |
| 8 | 2227069126 | 2225789003 | Unclassified | 2887 |
| 9 | 2227175247 | 2225789004 | Bacteria | 8144 |
| 10 | 2227493813 | 2225789004 | Bacteria | 3999 |
| 11 | 2227547422 | 2225789004 | Bacteria | 2901 |
| 12 | JGI24702J35022_10050810 | 3300002462 | Bacteria | 2209 |
| 13 | Ga0072941_1525298 | 3300005201 | Bacteria | 634 |
| 14 | Ga0466706_113361 | 3300042599 | Bacteria | 1697 |
| 15 | Ga0466707_320262 | 3300042601 | Bacteria | 11712 |
| 16 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 17 | Ga0466722_124104 | 3300042609 | Bacteria | 3997 |
| 18 | Ga0466693_404780 | 3300042592 | Bacteria | 2124 |
| 19 | Ga0466701_012723 | 3300042598 | Bacteria | 34655 |
| 20 | Ga0466705_077252 | 3300042612 | Unclassified | 1350 |
| 21 | Ga0466703_247850 | 3300042636 | Bacteria | 1495 |
| 22 | Ga0466706_035251 | 3300042599 | Bacteria | 6539 |
| 23 | Ga0466707_006720 | 3300042601 | Bacteria | 2960 |
| 24 | Ga0466726_259816 | 3300042619 | Bacteria | 17666 |
| 25 | Ga0466733_111650 | 3300042659 | Bacteria | 3847 |
| 26 | Ga0466704_446345 | 3300042643 | Bacteria | 18184 |
| 27 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 28 | IMNBL1DRAFT_c0002089 | 3300000062 | Bacteria | 14219 |
| 29 | Ga0466722_262887 | 3300042609 | Bacteria | 6333 |
| 30 | Ga0466715_463709 | 3300042616 | Bacteria | 1658 |
| 31 | Ga0466726_155600 | 3300042619 | Bacteria | 2191 |
| 32 | Ga0466729_191291 | 3300042621 | Bacteria | 5084 |
| 33 | Ga0466656_086203 | 3300042550 | Bacteria | 1475 |
| 34 | Ga0466733_037360 | 3300042659 | Bacteria | 17049 |
| 35 | Ga0466705_188062 | 3300042612 | Bacteria | 12718 |
| 36 | Ga0466735_170596 | 3300042624 | Bacteria | 3429 |
| 37 | Ga0466704_282105 | 3300042643 | Bacteria | 17912 |
| 38 | Ga0466704_355753 | 3300042643 | Bacteria | 30315 |
| 39 | JGI24702J35022_10262224 | 3300002462 | Bacteria | 1008 |
| 40 | JGI24702J35022_10749968 | 3300002462 | Bacteria | 607 |
| 41 | JGI24705J35276_11369725 | 3300002504 | Bacteria | 519 |
| 42 | JGI24705J35276_12204263 | 3300002504 | Bacteria | 1673 |
| 43 | JGI24705J35276_12238693 | 3300002504 | Bacteria | 38242 |
| 44 | Ga0068305_10008090 | 3300005083 | Bacteria | 27593 |
| 45 | Ga0466706_075458 | 3300042599 | Bacteria | 3480 |
| 46 | Ga0466722_238740 | 3300042609 | Bacteria | 4442 |
| 47 | Ga0466715_181682 | 3300042616 | Bacteria | 20637 |
| 48 | Ga0466715_481062 | 3300042616 | Bacteria | 3674 |
| 49 | Ga0466657_396857 | 3300042582 | Bacteria | 1264 |
| 50 | Ga0466691_049099 | 3300042593 | Bacteria | 6686 |
| 51 | Ga0123356_10054630 | 3300010049 | Bacteria | 3720 |
| 52 | Ga0466735_005137 | 3300042624 | Bacteria | 1287 |
| 53 | Ga0466735_193143 | 3300042624 | Bacteria | 5647 |
| 54 | JGI24702J35022_10241622 | 3300002462 | Bacteria | 1048 |
| 55 | Ga0068305_10122783 | 3300005083 | Unclassified | 3911 |
| 56 | Ga0466706_056255 | 3300042599 | Bacteria | 16301 |
| 57 | Ga0466711_266678 | 3300042615 | Bacteria | 13430 |
| 58 | Ga0466726_319631 | 3300042619 | Bacteria | 3020 |
| 59 | Ga0466728_348809 | 3300042620 | Bacteria | 15447 |
| 60 | Ga0466690_158539 | 3300042590 | Bacteria | 20384 |
| 61 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 62 | Ga0466691_016966 | 3300042593 | Bacteria | 13327 |
| 63 | Ga0466695_161488 | 3300042595 | Bacteria | 1517 |
| 64 | Ga0123356_11264911 | 3300010049 | Bacteria | 902 |
| 65 | Ga0466705_021372 | 3300042612 | Bacteria | 1120 |
| 66 | Ga0466735_009647 | 3300042624 | Bacteria | 5484 |
| 67 | Ga0466703_248560 | 3300042636 | Bacteria | 44932 |
| 68 | Ga0466703_405571 | 3300042636 | Bacteria | 5874 |
| 69 | Ga0466704_405525 | 3300042643 | Bacteria | 4406 |
| 70 | 2227336935 | 2225789004 | Unclassified | 1163 |
| 71 | 2227485211 | 2225789004 | Bacteria | 4271 |
| 72 | IMNBL1DRAFT_c0003452 | 3300000062 | Bacteria | 10153 |
| 73 | Ga0466706_044418 | 3300042599 | Bacteria | 19614 |
| 74 | Ga0466706_096120 | 3300042599 | Bacteria | 10775 |
| 75 | Ga0466706_107879 | 3300042599 | Bacteria | 14964 |
| 76 | Ga0466707_367694 | 3300042601 | Bacteria | 1055 |
| 77 | Ga0466713_089753 | 3300042602 | Bacteria | 35618 |
| 78 | Ga0466716_027932 | 3300042605 | Bacteria | 1079 |
| 79 | Ga0466716_087157 | 3300042605 | Bacteria | 5167 |
| 80 | Ga0466719_457011 | 3300042606 | Bacteria | 4492 |
| 81 | Ga0466715_301468 | 3300042616 | Bacteria | 5529 |
| 82 | Ga0466691_145457 | 3300042593 | Bacteria | 34874 |
| 83 | Ga0466696_468919 | 3300042596 | Bacteria | 1391 |
| 84 | Ga0466733_035995 | 3300042659 | Bacteria | 21364 |
| 85 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 86 | Ga0466704_047612 | 3300042643 | Bacteria | 21473 |
| 87 | Ga0466725_225704 | 3300042654 | Bacteria | 18706 |
| 88 | JGI24702J35022_10022385 | 3300002462 | Bacteria | 3420 |
| 89 | Ga0466701_077707 | 3300042598 | Bacteria | 1071 |
| 90 | Ga0466728_173422 | 3300042620 | Bacteria | 14015 |
| 91 | Ga0466728_464976 | 3300042620 | Bacteria | 20701 |
| 92 | Ga0466735_117034 | 3300042624 | Bacteria | 2268 |
| 93 | Ga0466735_138771 | 3300042624 | Bacteria | 3979 |
| 94 | Ga0466735_151783 | 3300042624 | Bacteria | 4458 |
| 95 | Ga0466703_214654 | 3300042636 | Bacteria | 3090 |
| 96 | Ga0466704_183759 | 3300042643 | Bacteria | 13467 |
| 97 | Ga0466725_256535 | 3300042654 | Bacteria | 3359 |
| 98 | Ga0466727_042327 | 3300042655 | Bacteria | 27947 |
| 99 | 2227480190 | 2225789004 | Bacteria | 22361 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02367 | TsaE | Threonylcarbamoyl adenosine biosynthesis protein TsaE | 37 | 163 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02367 | GO:0002949 | tRNA threonylcarbamoyladenosine modification | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.