Protein Family IF00885
Metagenome
Isolate
155
Members
46
Samples
150
Scaffolds
192.79
Avg Length
Representative Sequence
- ID
- 3300002504|JGI24705J35276_12228646|JGI24705J35276_122286464
- Length
- 216 aa
- Sequence
- LAEEEAKKLCHCGLDPQSLFYVILEKTKLKILGITFNQIQAGAYALILAEEKGNRRVPIIIGTPEAQSIAIFLENLRPPRPLTHDLFISFLQLANIVLKEVNIYKYEEGIFHSEMIFNDGVKDIFLDSRTSDAIALALRANAPIYMTSSIMKDVAIELEEEDINDNMEQAISNQSVSLDNLNPEKLQVLLNEAITNENYERASYIRDLIKEKNKR*
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.6%
Kalotermitidae
26.7%
Unclassified
15.6%
Rhinotermitidae
8.9%
Termopsidae
6.7%
Passalidae
4.4%
Blattidae
2.2%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 40 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_195293 | 3300042612 | Bacteria | 9820 |
| 2 | Ga0466715_217133 | 3300042616 | Bacteria | 2774 |
| 3 | Ga0466726_001905 | 3300042619 | Bacteria | 2133 |
| 4 | Ga0123353_10045543 | 3300010167 | Bacteria | 6962 |
| 5 | Ga0123353_10227186 | 3300010167 | Bacteria | 2913 |
| 6 | Ga0466690_156672 | 3300042590 | Bacteria | 6955 |
| 7 | Ga0466735_219569 | 3300042624 | Bacteria | 1707 |
| 8 | Ga0466704_460349 | 3300042643 | Bacteria | 29523 |
| 9 | Ga0466701_045332 | 3300042598 | Bacteria | 2606 |
| 10 | Ga0466701_072055 | 3300042598 | Bacteria | 39896 |
| 11 | Ga0466707_027448 | 3300042601 | Bacteria | 23788 |
| 12 | Ga0466707_086933 | 3300042601 | Bacteria | 12006 |
| 13 | JGI24705J35276_12231083 | 3300002504 | Bacteria | 3825 |
| 14 | JGI24699J35502_11133957 | 3300002509 | Bacteria | 21311 |
| 15 | Ga0123357_10221579 | 3300009784 | Bacteria | 2097 |
| 16 | Ga0123356_10385087 | 3300010049 | Bacteria | 1536 |
| 17 | Ga0123356_10990956 | 3300010049 | Bacteria | 1011 |
| 18 | Ga0123354_10040023 | 3300010882 | Bacteria | 7258 |
| 19 | Ga0466735_009714 | 3300042624 | Bacteria | 1035 |
| 20 | Ga0466735_016254 | 3300042624 | Bacteria | 6306 |
| 21 | Ga0466703_087048 | 3300042636 | Bacteria | 8460 |
| 22 | Ga0466704_181421 | 3300042643 | Bacteria | 11545 |
| 23 | Ga0466713_085699 | 3300042602 | Bacteria | 4533 |
| 24 | Ga0072941_1131337 | 3300005201 | Unclassified | 1976 |
| 25 | Ga0123357_10000610 | 3300009784 | Bacteria | 35456 |
| 26 | Ga0466711_004859 | 3300042615 | Bacteria | 4678 |
| 27 | Ga0123357_10023712 | 3300009784 | Bacteria | 8250 |
| 28 | Ga0123357_10091205 | 3300009784 | Bacteria | 3970 |
| 29 | Ga0123354_10196596 | 3300010882 | Bacteria | 2235 |
| 30 | Ga0123354_10315584 | 3300010882 | Bacteria | 1452 |
| 31 | Ga0466692_017114 | 3300042591 | Bacteria | 3484 |
| 32 | Ga0466696_303790 | 3300042596 | Bacteria | 26076 |
| 33 | Ga0466735_233672 | 3300042624 | Bacteria | 10329 |
| 34 | Ga0466703_135193 | 3300042636 | Bacteria | 22819 |
| 35 | Ga0466703_242721 | 3300042636 | Bacteria | 1883 |
| 36 | Ga0466704_246937 | 3300042643 | Bacteria | 5988 |
| 37 | Ga0466707_021102 | 3300042601 | Bacteria | 3024 |
| 38 | Ga0466720_200942 | 3300042607 | Bacteria | 1048 |
| 39 | IMNBL1DRAFT_c0000149 | 3300000062 | Bacteria | 62726 |
| 40 | Ga0466705_138715 | 3300042612 | Bacteria | 1839 |
| 41 | Ga0466715_236334 | 3300042616 | Bacteria | 29580 |
| 42 | Ga0466715_358682 | 3300042616 | Bacteria | 2690 |
| 43 | Ga0466728_380196 | 3300042620 | Bacteria | 3416 |
| 44 | Ga0466729_135253 | 3300042621 | Bacteria | 1479 |
| 45 | Ga0123354_10249216 | 3300010882 | Bacteria | 1805 |
| 46 | Ga0123354_10618818 | 3300010882 | Unclassified | 786 |
| 47 | Ga0466690_151487 | 3300042590 | Bacteria | 12165 |
| 48 | Ga0466692_009422 | 3300042591 | Bacteria | 48609 |
| 49 | Ga0466692_168589 | 3300042591 | Bacteria | 3355 |
| 50 | Ga0466694_328845 | 3300042594 | Unclassified | 1569 |
| 51 | Ga0466696_247227 | 3300042596 | Bacteria | 1069 |
| 52 | Ga0466734_069228 | 3300042623 | Bacteria | 1787 |
| 53 | Ga0466735_063617 | 3300042624 | Bacteria | 1530 |
| 54 | Ga0466735_158792 | 3300042624 | Bacteria | 2910 |
| 55 | Ga0466701_044629 | 3300042598 | Bacteria | 1175 |
| 56 | Ga0466700_124418 | 3300042600 | Bacteria | 8391 |
| 57 | Ga0466707_198095 | 3300042601 | Bacteria | 2077 |
| 58 | Ga0466713_108742 | 3300042602 | Bacteria | 24178 |
| 59 | Ga0466719_070956 | 3300042606 | Bacteria | 21918 |
| 60 | Ga0466719_577513 | 3300042606 | Bacteria | 1075 |
| 61 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 62 | IMNBL1DRAFT_c0001726 | 3300000062 | Bacteria | 16054 |
| 63 | JGI24705J35276_12228646 | 3300002504 | Bacteria | 3228 |
| 64 | Ga0466715_334251 | 3300042616 | Bacteria | 1051 |
| 65 | Ga0466726_089631 | 3300042619 | Bacteria | 8368 |
| 66 | Ga0466726_448104 | 3300042619 | Bacteria | 1939 |
| 67 | Ga0123357_10105096 | 3300009784 | Bacteria | 3623 |
| 68 | Ga0123357_10648700 | 3300009784 | Bacteria | 783 |
| 69 | Ga0123356_10007741 | 3300010049 | Bacteria | 10699 |
| 70 | Ga0123353_10326049 | 3300010167 | Bacteria | 2328 |
| 71 | Ga0123353_11411468 | 3300010167 | Bacteria | 894 |
| 72 | Ga0123354_10071319 | 3300010882 | Bacteria | 5015 |
| 73 | Ga0123354_10183277 | 3300010882 | Bacteria | 2379 |
| 74 | Ga0466656_324928 | 3300042550 | Bacteria | 15757 |
| 75 | Ga0466693_431500 | 3300042592 | Bacteria | 4046 |
| 76 | Ga0466691_121488 | 3300042593 | Bacteria | 8982 |
| 77 | Ga0466703_026780 | 3300042636 | Bacteria | 3552 |
| 78 | Ga0466703_037260 | 3300042636 | Unclassified | 1152 |
| 79 | Ga0466703_044336 | 3300042636 | Bacteria | 8251 |
| 80 | Ga0466709_030205 | 3300042648 | Bacteria | 36078 |
| 81 | Ga0466727_294284 | 3300042655 | Bacteria | 2336 |
| 82 | Ga0466700_481881 | 3300042600 | Bacteria | 18597 |
| 83 | Ga0466717_104549 | 3300042604 | Bacteria | 2463 |
| 84 | Ga0466716_547767 | 3300042605 | Bacteria | 1266 |
| 85 | 2227136378 | 2225789004 | Bacteria | 8812 |
| 86 | JGI24705J35276_12237510 | 3300002504 | Bacteria | 11491 |
| 87 | Ga0466705_019787 | 3300042612 | Bacteria | 48611 |
| 88 | Ga0466715_611912 | 3300042616 | Bacteria | 34451 |
| 89 | Ga0466729_151245 | 3300042621 | Bacteria | 10889 |
| 90 | Ga0123356_10328038 | 3300010049 | Bacteria | 1646 |
| 91 | Ga0123353_11587298 | 3300010167 | Bacteria | 827 |
| 92 | Ga0456237_0000028 | 3300041968 | Bacteria | 21979 |
| 93 | Ga0466735_128620 | 3300042624 | Bacteria | 1741 |
| 94 | Ga0466735_156449 | 3300042624 | Bacteria | 2450 |
| 95 | Ga0466704_121219 | 3300042643 | Bacteria | 15926 |
| 96 | Ga0466704_379904 | 3300042643 | Bacteria | 21264 |
| 97 | Ga0466709_219154 | 3300042648 | Bacteria | 176728 |
| 98 | Ga0466727_024795 | 3300042655 | Bacteria | 6155 |
| 99 | Ga0466700_155986 | 3300042600 | Bacteria | 14216 |
| 100 | Ga0466707_188758 | 3300042601 | Bacteria | 6274 |
| 101 | Ga0466707_211702 | 3300042601 | Bacteria | 1868 |
| 102 | Ga0466713_079755 | 3300042602 | Bacteria | 6344 |
| 103 | Ga0466713_152650 | 3300042602 | Bacteria | 6521 |
| 104 | Ga0466714_155116 | 3300042603 | Bacteria | 3515 |
| 105 | Ga0466719_369428 | 3300042606 | Bacteria | 1985 |
| 106 | Ga0466722_097876 | 3300042609 | Bacteria | 8868 |
| 107 | Ga0466722_111013 | 3300042609 | Bacteria | 1463 |
| 108 | 2227607670 | 2225789004 | Bacteria | 2288 |
| 109 | JGI24702J35022_10009483 | 3300002462 | Bacteria | 5462 |
| 110 | Ga0466715_189076 | 3300042616 | Bacteria | 24399 |
| 111 | Ga0123357_10087089 | 3300009784 | Bacteria | 4086 |
| 112 | Ga0123354_10035314 | 3300010882 | Bacteria | 7805 |
| 113 | Ga0123354_10323808 | 3300010882 | Bacteria | 1418 |
| 114 | Ga0466690_188044 | 3300042590 | Bacteria | 53126 |
| 115 | Ga0466690_366346 | 3300042590 | Bacteria | 19474 |
| 116 | Ga0466691_195596 | 3300042593 | Bacteria | 68522 |
| 117 | Ga0466696_094287 | 3300042596 | Bacteria | 16354 |
| 118 | Ga0466696_322115 | 3300042596 | Bacteria | 1078 |
| 119 | Ga0466735_214113 | 3300042624 | Bacteria | 1297 |
| 120 | Ga0466703_079266 | 3300042636 | Bacteria | 3538 |
| 121 | Ga0466727_021926 | 3300042655 | Bacteria | 50464 |
| 122 | Ga0466727_188673 | 3300042655 | Bacteria | 2939 |
| 123 | Ga0466727_287047 | 3300042655 | Bacteria | 2125 |
| 124 | Ga0466707_364656 | 3300042601 | Bacteria | 10988 |
| 125 | Ga0466713_072541 | 3300042602 | Bacteria | 3101 |
| 126 | Ga0466722_075116 | 3300042609 | Bacteria | 1619 |
| 127 | 2227247440 | 2225789004 | Bacteria | 32709 |
| 128 | 2227273845 | 2225789004 | Bacteria | 1273 |
| 129 | IMNBL1DRAFT_c0002065 | 3300000062 | Bacteria | 14345 |
| 130 | Ga0466715_068961 | 3300042616 | Bacteria | 18537 |
| 131 | Ga0466726_134146 | 3300042619 | Bacteria | 3895 |
| 132 | Ga0466726_228209 | 3300042619 | Bacteria | 2722 |
| 133 | Ga0123357_10005009 | 3300009784 | Bacteria | 15746 |
| 134 | Ga0123357_10145652 | 3300009784 | Bacteria | 2895 |
| 135 | Ga0123357_10264323 | 3300009784 | Bacteria | 1812 |
| 136 | Ga0123354_10455799 | 3300010882 | Bacteria | 1032 |
| 137 | Ga0123354_10505032 | 3300010882 | Bacteria | 940 |
| 138 | Ga0466692_015306 | 3300042591 | Unclassified | 1620 |
| 139 | Ga0466692_167512 | 3300042591 | Bacteria | 9598 |
| 140 | Ga0466693_200785 | 3300042592 | Bacteria | 1031 |
| 141 | Ga0466694_063549 | 3300042594 | Bacteria | 1839 |
| 142 | Ga0466703_003984 | 3300042636 | Bacteria | 12123 |
| 143 | Ga0466704_056912 | 3300042643 | Bacteria | 6299 |
| 144 | Ga0466727_188305 | 3300042655 | Bacteria | 3302 |
| 145 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 146 | Ga0466707_062556 | 3300042601 | Bacteria | 45654 |
| 147 | Ga0466713_096332 | 3300042602 | Bacteria | 24639 |
| 148 | Ga0466719_044333 | 3300042606 | Bacteria | 5600 |
| 149 | JGI24702J35022_10004538 | 3300002462 | Bacteria | 8237 |
| 150 | Ga0068305_10101887 | 3300005083 | Bacteria | 4092 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02577 | GO:0004518 | nuclease activity | MF |
| PF02151 | GO:0005515 | protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.