Protein Family IF00869

Metagenome Isolate
188 Members
94 Samples
139 Scaffolds
437.32 Avg Length

🧬 Representative Sequence

ID
3300002501|JGI24703J35330_11748815|JGI24703J35330_1174881532
Length
491 aa
Sequence
MDLRGFRKELDIFDSCRNMGKIEKIIGMTIEASGPSCNIGDVCRIFSKDMKEFVYAEVVGFNSSKVLLMPYTDIEGIGPGSIVDNTGEKLMVKTTPDLVGRIIDAIGRPLDGKGEIEYTGSLPITGISVNPLTRPKISEPLEMGVKAIDGLLTLGKGQRIGIFAGSGVGKSTLMGMVARKVKADLNVIALVGERGREVREFIENDLGDEGMARSVVVVATGDQPAMLRNKCPLTATAIAEYFMQQGKDVLLMMDNLTRFAMAQREVGLSIGEPPIARGYTPSIYSALPKLLERAGSFETGSITGIYAVLVEGDDTNEPISDTVRGIIDGHIILSRKIAARNHYPAIDILGSISRLMTIICPEDHNEAANRLRDLLALYDDNYDLITIGAYKKGTNPKLDEAIDKIDEINAFLKQKVNESFDLDETVAMLKQVVVADKAGNRRPVGAMSGTLGASGGAGISNQPTPEQLLQQAQGSPYSPSSGGAGQTAVV*

📊 Sample Types

Isolate 26.1%
Metagenome 73.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.3%
Termitidae 21.1%
Kalotermitidae 11.1%
Blattidae 10.0%
Elmidae 4.4%
Culicidae 3.3%
Rhinotermitidae 3.3%
Armadillidiidae 2.2%
Nephropidae 1.1%
Noctuidae 1.1%
Termopsidae 1.1%
Tenebrionidae 1.1%
Curculionidae 1.1%
Coreidae 1.1%
Porcellionidae 1.1%
Passalidae 1.1%
Hydrophilidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864937364 Acidovorax soli S00198 Isolate Elmidae
2 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
3 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
4 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
5 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
6 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
11 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
17 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
18 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
19 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
20 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
21 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
27 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
28 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
29 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
30 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2864801025 Bacillus aerius S00042 Isolate Elmidae
34 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
35 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
36 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 2864895409 Bacillus aerius S00152 Isolate Elmidae
39 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
40 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
41 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
42 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
43 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
44 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
45 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
46 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
47 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
48 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
49 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
50 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
51 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
56 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
57 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
58 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
59 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
62 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
63 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
64 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
65 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
66 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
67 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
68 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
69 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
70 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
71 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
72 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
73 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
74 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
75 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
78 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
79 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
80 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
81 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
82 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
83 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
84 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
85 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
86 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
87 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
88 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
89 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
90 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
91 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
92 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
93 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
94 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10281790 3300010049 Bacteria 1758
2 Ga0123353_10061601 3300010167 Bacteria 6017
3 Ga0123354_10003644 3300010882 Bacteria 21371
4 Ga0466733_001402 3300042659 Bacteria 14257
5 Ga0466701_063665 3300042598 Bacteria 121183
6 Ga0466706_097354 3300042599 Unclassified 7404
7 Ga0466706_193086 3300042599 Unclassified 5485
8 Ga0466721_065983 3300042608 Bacteria 17419
9 Ga0160455_100014 3300012837 Bacteria 483318
10 Ga0466696_215093 3300042596 Bacteria 2662
11 JGI24702J35022_10002466 3300002462 Bacteria 11291
12 Ga0072940_1074278 3300005200 Bacteria 2593
13 Ga0072940_1077712 3300005200 Bacteria 3134
14 Ga0072941_1009033 3300005201 Bacteria 8786
15 Ga0072941_1047732 3300005201 Bacteria 12684
16 Ga0466703_044066 3300042636 Bacteria 1564
17 Ga0466704_064085 3300042643 Bacteria 388657
18 Ga0466704_164591 3300042643 Bacteria 88701
19 Ga0160454_100018 3300012798 Bacteria 326271
20 Ga0466705_197160 3300042612 Bacteria 3277
21 Ga0466715_356515 3300042616 Bacteria 18946
22 Ga0466706_063946 3300042599 Bacteria 37826
23 Ga0466706_077647 3300042599 Bacteria 12505
24 Ga0466706_147628 3300042599 Unclassified 4324
25 Ga0466706_164052 3300042599 Bacteria 208763
26 Ga0466721_138292 3300042608 Bacteria 2900
27 Ga0466722_192099 3300042609 Bacteria 92456
28 Ga0160472_106018 3300012839 Bacteria 1862
29 Ga0466693_218860 3300042592 Bacteria 2463
30 Ga0063521_1000974 3300003973 Bacteria 9243
31 Ga0072940_1126053 3300005200 Unclassified 6537
32 Ga0123353_10070859 3300010167 Bacteria 5601
33 Ga0562379_0352 3300056790 Bacteria 109127
34 Ga0466715_054449 3300042616 Bacteria 20065
35 Ga0466723_015357 3300042618 Bacteria 4442
36 Ga0466723_043513 3300042618 Bacteria 11582
37 Ga0466706_089626 3300042599 Bacteria 23631
38 Ga0466706_107608 3300042599 Bacteria 10439
39 Ga0466706_147182 3300042599 Bacteria 6606
40 Ga0466706_231484 3300042599 Unclassified 7721
41 Ga0466706_250289 3300042599 Bacteria 7424
42 Ga0466706_289260 3300042599 Bacteria 2224
43 Ga0466716_123682 3300042605 Bacteria 132543
44 Ga0466692_091327 3300042591 Bacteria 32670
45 2227513536 2225789004 Bacteria 17986
46 JGI24703J35330_11748815 3300002501 Bacteria 40125
47 JGI24705J35276_12237689 3300002504 Bacteria 12558
48 Ga0466703_286621 3300042636 Bacteria 31377
49 Ga0123356_10000021 3300010049 Bacteria 176996
50 Ga0123356_10144531 3300010049 Bacteria 2351
51 Ga0466715_052477 3300042616 Bacteria 7960
52 Ga0466723_267344 3300042618 Bacteria 7165
53 Ga0466728_113606 3300042620 Bacteria 2440
54 Ga0466706_202901 3300042599 Bacteria 8120
55 Ga0466706_237730 3300042599 Bacteria 20408
56 Ga0466714_072370 3300042603 Bacteria 11147
57 Ga0415639_003286 3300038395 Bacteria 56769
58 Ga0415639_003489 3300038395 Bacteria 30262
59 Ga0415639_009362 3300038395 Bacteria 20604
60 Ga0415639_010516 3300038395 Bacteria 10052
61 Ga0415639_111051 3300038395 Unclassified 5169
62 JGI24702J35022_10003781 3300002462 Bacteria 9097
63 Ga0466702_205562 3300042635 Bacteria 1759
64 Ga0466702_378261 3300042635 Bacteria 4346
65 Ga0123355_10124935 3300009826 Bacteria 3979
66 Ga0123356_10014968 3300010049 Unclassified 7442
67 Ga0123356_10172490 3300010049 Bacteria 2175
68 Ga0466733_107473 3300042659 Bacteria 6053
69 Ga0466733_187866 3300042659 Bacteria 2330
70 Ga0466715_366951 3300042616 Bacteria 22918
71 Ga0466706_012433 3300042599 Bacteria 76595
72 Ga0466706_018452 3300042599 Bacteria 54272
73 Ga0466706_091489 3300042599 Bacteria 50051
74 Ga0466706_122442 3300042599 Bacteria 110911
75 Ga0466706_140640 3300042599 Bacteria 14900
76 Ga0466706_158486 3300042599 Bacteria 10110
77 Ga0466706_165413 3300042599 Unclassified 7935
78 Ga0466706_182332 3300042599 Bacteria 21381
79 Ga0466706_235766 3300042599 Bacteria 3076
80 Ga0466714_073203 3300042603 Bacteria 47226
81 Ga0466719_007898 3300042606 Bacteria 2474
82 Ga0415639_001826 3300038395 Bacteria 43745
83 Ga0415639_001914 3300038395 Bacteria 21167
84 Ga0415639_005306 3300038395 Bacteria 40315
85 Ga0415639_009295 3300038395 Bacteria 2204
86 Ga0415639_071627 3300038395 Bacteria 20757
87 Ga0466696_031977 3300042596 Bacteria 9061
88 Ga0072941_1012607 3300005201 Bacteria 25516
89 Ga0466704_433946 3300042643 Bacteria 3414
90 Ga0123356_10006261 3300010049 Bacteria 12016
91 Ga0123356_10008835 3300010049 Bacteria 9978
92 Ga0466715_213381 3300042616 Bacteria 1445
93 Ga0466707_204796 3300042601 Bacteria 17774
94 Ga0466698_085302 3300042610 Bacteria 3094
95 Ga0415639_003747 3300038395 Bacteria 47783
96 AustNasuHG_c1000009 3300000089 Bacteria 54182
97 Ga0072941_1035979 3300005201 Unclassified 8452
98 Ga0466702_450343 3300042635 Bacteria 22416
99 Ga0123356_10123030 3300010049 Bacteria 2527
100 Ga0123353_10000210 3300010167 Bacteria 74209
101 Ga0466705_281070 3300042612 Bacteria 46866
102 Ga0466726_239004 3300042619 Bacteria 26340
103 Ga0466706_044311 3300042599 Bacteria 66484
104 Ga0466706_141960 3300042599 Bacteria 10037
105 Ga0466706_230473 3300042599 Bacteria 13380
106 Ga0466706_233582 3300042599 Bacteria 3497
107 Ga0466716_173266 3300042605 Bacteria 5773
108 Ga0466721_160537 3300042608 Bacteria 71411
109 Ga0160467_100807 3300012829 Bacteria 20999
110 Ga0160447_101633 3300012849 Unclassified 8544
111 Ga0160435_1004852 3300012857 Bacteria 3091
112 Ga0415639_054312 3300038395 Bacteria 19658
113 Ga0415639_115546 3300038395 Bacteria 1527
114 JGI24702J35022_10023777 3300002462 Bacteria 3312
115 Ga0123356_10052108 3300010049 Bacteria 3806
116 Ga0123353_10078628 3300010167 Bacteria 5301
117 Ga0123353_10255801 3300010167 Unclassified 2709
118 Ga0562379_0335 3300056790 Bacteria 115222
119 Ga0466705_106827 3300042612 Bacteria 52611
120 Ga0466705_321332 3300042612 Bacteria 14109
121 Ga0466729_148217 3300042621 Bacteria 33223
122 Ga0466706_124855 3300042599 Bacteria 9609
123 Ga0466706_169045 3300042599 Unclassified 6781
124 Ga0466706_170418 3300042599 Unclassified 2346
125 Ga0466706_220349 3300042599 Bacteria 1432
126 Ga0466707_235204 3300042601 Unclassified 3758
127 Ga0466714_125379 3300042603 Bacteria 1554
128 Ga0466716_270313 3300042605 Bacteria 2401
129 Ga0466721_117367 3300042608 Bacteria 20226
130 Ga0466722_162527 3300042609 Bacteria 3956
131 Ga0160452_100096 3300012834 Bacteria 116013
132 Ga0160435_1003417 3300012857 Bacteria 3756
133 Ga0466696_089674 3300042596 Bacteria 1824
134 Ga0072940_1126052 3300005200 Bacteria 6530
135 Ga0072941_1032947 3300005201 Bacteria 9641
136 Ga0072941_1128989 3300005201 Unclassified 7048
137 Ga0123357_10000023 3300009784 Bacteria 136176
138 Ga0466704_117584 3300042643 Bacteria 58461
139 Ga0466708_372274 3300042652 Unclassified 3456

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 144 353 0.99
PF18269 T3SS_ATPase_C T3SS EscN ATPase C-terminal domain 361 431 0.98
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 23 87 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00006 GO:0005524 ATP binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.