Protein Family IF00863

Metagenome Isolate
120 Members
64 Samples
104 Scaffolds
342.23 Avg Length

🧬 Representative Sequence

ID
3300002501|JGI24703J35330_11624370|JGI24703J35330_116243701
Length
346 aa
Sequence
MRKSEDAQALIIPNATAEFLTFAFQTGGDGIEIRVQDGTVWLSQKLMAQLFDTTPENIISHIKSITKEAELDPEATTKDFLVVQIEGTRSVNRKIKHYNLDMIIAVGYRVNSGKATAFRRWAITVLRDFALRGYVIDKERMKNGTFFNDDYFEHLLAEIREIRLSERRFHQKITDIYSTAMDYNKDAPTTRDFFAKVQNKLHWAIHGHTAAELIYKRADSEKQHMGLSTWQNAPSGKILKKDVAVAKNYLTQDEIKDLELVVSGYLDLAEALAKRKVPMTMDEWSEHLDMILRASKYEILDNLGSITKEIAKMHAEAEFAKYRVVQDKLFESDFDKFIETTGEIL*

📊 Sample Types

Isolate 13.3%
Metagenome 86.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.1%
Blattidae 22.6%
Kalotermitidae 21.0%
Unclassified 6.5%
Termopsidae 6.5%
Passalidae 3.2%
Hodotermitidae 1.6%
Rhinotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
15 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
16 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
23 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
28 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
29 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
30 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
31 3004672520 Bacteroides sp. 51 Isolate Blattidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
48 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
49 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
52 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
53 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
58 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
59 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
60 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
63 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
64 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 2227466304 2225789004 Unclassified 24553
2 IMNBL1DRAFT_c0019152 3300000062 Bacteria 2815
3 AustNasuHG_c1023980 3300000089 Bacteria 1940
4 Ga0072941_1016130 3300005201 Unclassified 14960
5 Ga0466695_262320 3300042595 Bacteria 38774
6 Ga0466711_005989 3300042615 Bacteria 2167
7 Ga0466728_114650 3300042620 Bacteria 8762
8 Ga0466719_022987 3300042606 Bacteria 1279
9 Ga0466720_080892 3300042607 Bacteria 26978
10 Ga0466733_070281 3300042659 Bacteria 14721
11 Ga0466703_253475 3300042636 Bacteria 2758
12 Ga0466727_204804 3300042655 Bacteria 1654
13 JGI24698J34947_10022927 3300002449 Bacteria 3341
14 JGI24702J35022_10080748 3300002462 Bacteria 1761
15 Ga0466696_124173 3300042596 Unclassified 1124
16 Ga0466705_460186 3300042612 Bacteria 1639
17 Ga0466712_129135 3300042614 Bacteria 16333
18 Ga0466718_014690 3300042617 Bacteria 8638
19 Ga0466728_049858 3300042620 Bacteria 1515
20 Ga0466707_109763 3300042601 Bacteria 1478
21 Ga0466732_226497 3300042656 Bacteria 4339
22 Ga0123353_10004826 3300010167 Bacteria 17512
23 Ga0466731_416896 3300042622 Bacteria 1958
24 Ga0466735_110396 3300042624 Bacteria 1721
25 Ga0466703_289327 3300042636 Bacteria 1191
26 IMNBL1DRAFT_c0002597 3300000062 Bacteria 12416
27 IMNBL1DRAFT_c0012004 3300000062 Bacteria 3993
28 IMNBL1DRAFT_c0012646 3300000062 Bacteria 3844
29 JGI24698J34947_10004441 3300002449 Bacteria 7637
30 JGI24698J34947_10016164 3300002449 Bacteria 4053
31 JGI24698J34947_10092660 3300002449 Unclassified 1381
32 Ga0068305_10162891 3300005083 Bacteria 5560
33 Ga0466715_172861 3300042616 Unclassified 2916
34 Ga0466705_047522 3300042612 Bacteria 12961
35 Ga0466733_156408 3300042659 Bacteria 45949
36 Ga0123355_10136167 3300009826 Bacteria 3772
37 Ga0123353_10629268 3300010167 Bacteria 1525
38 Ga0466704_219592 3300042643 Bacteria 2021
39 Ga0466708_101376 3300042652 Bacteria 1432
40 IMNBL1DRAFT_c0038564 3300000062 Unclassified 1642
41 JGI24698J34947_10020663 3300002449 Bacteria 3544
42 JGI24703J35330_11624370 3300002501 Unclassified 1467
43 Ga0415639_119326 3300038395 Unclassified 1821
44 Ga0466696_102909 3300042596 Bacteria 5338
45 Ga0466699_131041 3300042597 Archaea 2347
46 Ga0466726_309011 3300042619 Bacteria 1399
47 Ga0466716_016699 3300042605 Bacteria 2538
48 Ga0466720_007877 3300042607 Bacteria 20619
49 Ga0466720_030889 3300042607 Bacteria 5804
50 Ga0466720_097898 3300042607 Bacteria 5518
51 Ga0466720_112167 3300042607 Bacteria 13198
52 Ga0466698_358110 3300042610 Bacteria 1373
53 Ga0123357_10159219 3300009784 Bacteria 2712
54 Ga0123353_10653119 3300010167 Unclassified 1488
55 Ga0123354_10074080 3300010882 Bacteria 4882
56 Ga0466709_080197 3300042648 Bacteria 10370
57 2227474624 2225789004 Bacteria 22862
58 AustNasuHG_c1005440 3300000089 Bacteria 4551
59 Ga0068302_10043293 3300005071 Bacteria 2057
60 Ga0072941_1008778 3300005201 Bacteria 22332
61 Ga0466691_030038 3300042593 Bacteria 51774
62 Ga0466728_342924 3300042620 Bacteria 1444
63 Ga0466707_396095 3300042601 Bacteria 1578
64 Ga0466704_214858 3300042643 Bacteria 4153
65 2227447468 2225789004 Unclassified 5444
66 IMNBL1DRAFT_c0018807 3300000062 Bacteria 2856
67 FAAS_10007610 3300001880 Bacteria 1101
68 JGI24698J34947_10027286 3300002449 Bacteria 3031
69 JGI24695J34938_10095979 3300002450 Bacteria 1214
70 Ga0466657_033384 3300042582 Bacteria 3004
71 Ga0466701_005263 3300042598 Bacteria 1503
72 Ga0466715_212643 3300042616 Bacteria 2056
73 Ga0466718_138905 3300042617 Bacteria 1544
74 Ga0466706_092568 3300042599 Bacteria 5815
75 Ga0466707_420126 3300042601 Bacteria 1496
76 Ga0466705_144279 3300042612 Bacteria 5695
77 Ga0466732_068883 3300042656 Bacteria 2735
78 Ga0123353_10741224 3300010167 Bacteria 1369
79 Ga0123354_10044285 3300010882 Bacteria 6827
80 Ga0466731_274714 3300042622 Bacteria 5633
81 Ga0466704_363579 3300042643 Bacteria 24250
82 Ga0466709_075648 3300042648 Bacteria 4824
83 IMNBL1DRAFT_c0008518 3300000062 Bacteria 5208
84 IMNBL1DRAFT_c0017232 3300000062 Unclassified 3051
85 Ga0466696_177856 3300042596 Bacteria 1504
86 Ga0466696_391746 3300042596 Bacteria 10993
87 Ga0466699_357835 3300042597 Bacteria 3784
88 Ga0466705_415237 3300042612 Bacteria 5041
89 Ga0466700_332611 3300042600 Bacteria 1611
90 Ga0466722_147025 3300042609 Bacteria 4772
91 Ga0466733_032077 3300042659 Unclassified 6299
92 Ga0123356_10375569 3300010049 Bacteria 1553
93 Ga0123353_10000797 3300010167 Bacteria 38391
94 Ga0466703_014351 3300042636 Bacteria 16224
95 Ga0466704_321521 3300042643 Bacteria 4723
96 Ga0466708_061962 3300042652 Bacteria 3387
97 2227492706 2225789004 Bacteria 4036
98 JGI24698J34947_10030619 3300002449 Unclassified 2837
99 JGI24698J34947_10089756 3300002449 Bacteria 1414
100 Ga0466690_045452 3300042590 Bacteria 6413
101 Ga0466690_085600 3300042590 Bacteria 3415
102 Ga0466695_070566 3300042595 Bacteria 1828
103 Ga0466696_474308 3300042596 Bacteria 2215
104 Ga0466712_069687 3300042614 Bacteria 15367

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_226497 Ga0466732_226497_240_1154 304
2 3300042596 Ga0466696_124173 Ga0466696_124173_158_1099 313
3 3300042620 Ga0466728_114650 Ga0466728_114650_3767_4804 314
4 3300042601 Ga0466707_396095 Ga0466707_396095_235_1266 322
5 3300042636 Ga0466703_289327 Ga0466703_289327_67_1035 322
6 3300042593 Ga0466691_030038 Ga0466691_030038_713_1750 325
7 3300001880 FAAS_10007610 FAAS_100076101 327
8 3300042659 Ga0466733_156408 Ga0466733_156408_21542_22537 331
9 3300042643 Ga0466704_214858 Ga0466704_214858_2255_3256 333
10 iso_pr_bacteria 2940195863 2940197811 336
11 3300042598 Ga0466701_005263 Ga0466701_005263_324_1337 337
12 3300042619 Ga0466726_309011 Ga0466726_309011_124_1137 337
13 3300042652 Ga0466708_101376 Ga0466708_101376_373_1386 337
14 3300042659 Ga0466733_032077 Ga0466733_032077_2903_3916 337
15 3300042659 Ga0466733_070281 Ga0466733_070281_7051_8064 337
16 2225789004 2227474624 2227924972 338
17 3300000062 IMNBL1DRAFT_c0012646 IMNBL1DRAFT_00126462 338
18 3300000062 IMNBL1DRAFT_c0012004 IMNBL1DRAFT_00120042 339
19 3300000062 IMNBL1DRAFT_c0019152 IMNBL1DRAFT_00191524 339
20 3300042601 Ga0466707_420126 Ga0466707_420126_132_1151 339
21 3300042620 Ga0466728_049858 Ga0466728_049858_108_1127 339
22 3300042622 Ga0466731_274714 Ga0466731_274714_2859_3878 339
23 3300042643 Ga0466704_219592 Ga0466704_219592_346_1365 339
24 3300042648 Ga0466709_075648 Ga0466709_075648_3141_4160 339
25 3300042652 Ga0466708_061962 Ga0466708_061962_15_1034 339
26 3300042656 Ga0466732_068883 Ga0466732_068883_1371_2390 339
27 3300042609 Ga0466722_147025 Ga0466722_147025_1307_2329 340
28 iso_pr_bacteria 2740892546 2743910396 340
29 2225789004 2227447468 2227884965 341
30 3300002449 JGI24698J34947_10016164 JGI24698J34947_100161644 341
31 3300002449 JGI24698J34947_10022927 JGI24698J34947_100229272 341
32 3300002449 JGI24698J34947_10027286 JGI24698J34947_100272862 341
33 3300002449 JGI24698J34947_10089756 JGI24698J34947_100897562 341
34 3300002449 JGI24698J34947_10092660 JGI24698J34947_100926601 341
35 3300005201 Ga0072941_1008778 Ga0072941_10087786 341
36 3300005201 Ga0072941_1016130 Ga0072941_10161302 341
37 3300010167 Ga0123353_10741224 Ga0123353_107412242 341
38 3300042595 Ga0466695_070566 Ga0466695_070566_229_1254 341
39 3300042607 Ga0466720_007877 Ga0466720_007877_10490_11515 341
40 3300042607 Ga0466720_030889 Ga0466720_030889_1161_2186 341
41 3300042607 Ga0466720_097898 Ga0466720_097898_378_1403 341
42 3300042607 Ga0466720_112167 Ga0466720_112167_8488_9513 341
43 3300042610 Ga0466698_358110 Ga0466698_358110_152_1177 341
44 3300042612 Ga0466705_144279 Ga0466705_144279_3251_4276 341
45 3300042614 Ga0466712_069687 Ga0466712_069687_5583_6608 341
46 3300042624 Ga0466735_110396 Ga0466735_110396_488_1513 341
47 3300000089 AustNasuHG_c1005440 AustNasuHG_10054402 342
48 3300002449 JGI24698J34947_10004441 JGI24698J34947_100044414 342
49 3300002449 JGI24698J34947_10030619 JGI24698J34947_100306193 342
50 3300009784 Ga0123357_10159219 Ga0123357_101592192 342
51 3300010882 Ga0123354_10074080 Ga0123354_100740805 342
52 3300042582 Ga0466657_033384 Ga0466657_033384_672_1700 342
53 3300042597 Ga0466699_357835 Ga0466699_357835_799_1827 342
54 3300042605 Ga0466716_016699 Ga0466716_016699_1301_2329 342
55 3300042606 Ga0466719_022987 Ga0466719_022987_93_1121 342
56 3300042612 Ga0466705_415237 Ga0466705_415237_1087_2115 342
57 3300042655 Ga0466727_204804 Ga0466727_204804_435_1463 342
58 3300002450 JGI24695J34938_10095979 JGI24695J34938_100959792 343
59 3300042590 Ga0466690_085600 Ga0466690_085600_343_1374 343
60 3300042596 Ga0466696_474308 Ga0466696_474308_325_1356 343
61 3300042622 Ga0466731_416896 Ga0466731_416896_771_1802 343
62 3300042636 Ga0466703_253475 Ga0466703_253475_1313_2344 343
63 iso_pr_bacteria 2781125690 2781428472 343
64 2225789004 2227466304 2227905679 344
65 2225789004 2227492706 2227966527 344
66 3300000062 IMNBL1DRAFT_c0018807 IMNBL1DRAFT_00188074 344
67 3300002449 JGI24698J34947_10020663 JGI24698J34947_100206633 344
68 3300002462 JGI24702J35022_10080748 JGI24702J35022_100807482 344
69 3300010167 Ga0123353_10629268 Ga0123353_106292682 344
70 3300042590 Ga0466690_045452 Ga0466690_045452_4199_5233 344
71 3300042596 Ga0466696_391746 Ga0466696_391746_456_1490 344
72 3300042599 Ga0466706_092568 Ga0466706_092568_1596_2630 344
73 3300042601 Ga0466707_109763 Ga0466707_109763_382_1416 344
74 3300042607 Ga0466720_080892 Ga0466720_080892_7519_8553 344
75 3300042614 Ga0466712_129135 Ga0466712_129135_3779_4813 344
76 3300042615 Ga0466711_005989 Ga0466711_005989_381_1415 344
77 3300042643 Ga0466704_321521 Ga0466704_321521_673_1707 344
78 iso_pr_bacteria 3004672520 3004673598 344
79 3300000062 IMNBL1DRAFT_c0002597 IMNBL1DRAFT_00025973 345
80 3300000062 IMNBL1DRAFT_c0008518 IMNBL1DRAFT_00085184 345
81 3300000062 IMNBL1DRAFT_c0017232 IMNBL1DRAFT_00172323 345
82 3300000062 IMNBL1DRAFT_c0038564 IMNBL1DRAFT_00385642 345
83 3300000089 AustNasuHG_c1023980 AustNasuHG_10239802 345
84 3300010049 Ga0123356_10375569 Ga0123356_103755691 345
85 3300010882 Ga0123354_10044285 Ga0123354_100442853 345
86 3300042617 Ga0466718_014690 Ga0466718_014690_6974_8011 345
87 iso_pr_bacteria 2940205530 2940209198 345
88 iso_pr_bacteria 2940212447 2940216112 345
89 iso_pr_bacteria 2940298504 2940302137 345
90 iso_pr_bacteria 2940302308 2940305985 345
91 iso_pr_bacteria 2940306115 2940309842 345
92 iso_pr_bacteria 2940309933 2940313603 345
93 iso_pr_bacteria 2940313741 2940317467 345
94 iso_pr_bacteria 2940317558 2940321251 345
95 iso_pr_bacteria 2940321370 2940325093 345
96 iso_pr_bacteria 2940325180 2940328883 345
97 iso_pr_bacteria 2940328985 2940332693 345
98 iso_pr_bacteria 2940332795 2940336518 345
99 3300002501 JGI24703J35330_11624370 JGI24703J35330_116243701 346
100 3300010167 Ga0123353_10653119 Ga0123353_106531192 346
101 3300042595 Ga0466695_262320 Ga0466695_262320_31784_32824 346
102 3300042617 Ga0466718_138905 Ga0466718_138905_278_1318 346
103 3300005071 Ga0068302_10043293 Ga0068302_100432932 347
104 3300009826 Ga0123355_10136167 Ga0123355_101361672 347
105 3300042596 Ga0466696_102909 Ga0466696_102909_541_1584 347
106 3300042596 Ga0466696_177856 Ga0466696_177856_335_1378 347
107 3300042597 Ga0466699_131041 Ga0466699_131041_255_1298 347
108 3300042612 Ga0466705_047522 Ga0466705_047522_4703_5746 347
109 3300042636 Ga0466703_014351 Ga0466703_014351_8560_9603 347
110 3300042648 Ga0466709_080197 Ga0466709_080197_5335_6378 347
111 3300042616 Ga0466715_172861 Ga0466715_172861_224_1270 348
112 3300010167 Ga0123353_10004826 Ga0123353_1000482614 350
113 3300042643 Ga0466704_363579 Ga0466704_363579_22170_23228 352
114 3300010167 Ga0123353_10000797 Ga0123353_100007979 353
115 3300042620 Ga0466728_342924 Ga0466728_342924_151_1212 353
116 3300042600 Ga0466700_332611 Ga0466700_332611_422_1486 354
117 3300005083 Ga0068305_10162891 Ga0068305_101628912 361
118 3300042616 Ga0466715_212643 Ga0466715_212643_135_1223 362
119 3300038395 Ga0415639_119326 Ga0415639_119326_641_1744 367
120 3300042612 Ga0466705_460186 Ga0466705_460186_181_1293 370

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13310 Virulence_RhuM Virulence protein RhuM family 75 328 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.46 0.53 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.