Protein Family IF00826
Metagenome
Isolate
185
Members
62
Samples
162
Scaffolds
153.98
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10448563|JGI24702J35022_104485631
- Length
- 172 aa
- Sequence
- MEIENQLTGGDSMGKFSKAGGREMPELNTTSLPDLVFAILFFFMMITTMREVTLKVQFRSPQATELQKLEKKSLITFIYVGKPINAELITKLGTESRIQLNDQIAEIAEVGAYIGQEKASMKEEDQPFMTTSIKADFETRMSIITDLKQALREAYALKISYSARPRSPGSR*
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
37.7%
Kalotermitidae
23.0%
Termitidae
21.3%
Termopsidae
6.6%
Unclassified
4.9%
Passalidae
3.3%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 14 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 15 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 18 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 19 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 20 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 27 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 28 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 38 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 44 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 45 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 46 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 47 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 54 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 60 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 61 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_201058 | 3300042611 | Bacteria | 1969 |
| 2 | IMNBL1DRAFT_c0003807 | 3300000062 | Bacteria | 9410 |
| 3 | JGI24702J35022_10037744 | 3300002462 | Bacteria | 2580 |
| 4 | JGI24702J35022_10111432 | 3300002462 | Bacteria | 1505 |
| 5 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 6 | Ga0068305_10017836 | 3300005083 | Bacteria | 19003 |
| 7 | Ga0466705_399685 | 3300042612 | Unclassified | 2115 |
| 8 | Ga0466711_009877 | 3300042615 | Bacteria | 14278 |
| 9 | Ga0466726_005153 | 3300042619 | Bacteria | 16947 |
| 10 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 11 | Ga0466728_438356 | 3300042620 | Bacteria | 29481 |
| 12 | Ga0466706_050074 | 3300042599 | Bacteria | 18582 |
| 13 | Ga0466716_059727 | 3300042605 | Bacteria | 9929 |
| 14 | Ga0466719_068358 | 3300042606 | Bacteria | 7078 |
| 15 | Ga0466704_043621 | 3300042643 | Bacteria | 12179 |
| 16 | Ga0466704_095285 | 3300042643 | Bacteria | 3139 |
| 17 | Ga0466704_393392 | 3300042643 | Bacteria | 8481 |
| 18 | Ga0466704_438870 | 3300042643 | Bacteria | 17990 |
| 19 | Ga0466656_224030 | 3300042550 | Bacteria | 11159 |
| 20 | Ga0466690_402356 | 3300042590 | Bacteria | 64397 |
| 21 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 22 | Ga0466696_433878 | 3300042596 | Unclassified | 1301 |
| 23 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 24 | Ga0466733_184071 | 3300042659 | Bacteria | 32833 |
| 25 | IMNBL1DRAFT_c0030229 | 3300000062 | Bacteria | 1990 |
| 26 | JGI24702J35022_10394775 | 3300002462 | Bacteria | 834 |
| 27 | JGI24696J40584_12960523 | 3300002834 | Unclassified | 7479 |
| 28 | Ga0466710_163935 | 3300042613 | Bacteria | 2060 |
| 29 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 30 | Ga0123353_11391237 | 3300010167 | Bacteria | 903 |
| 31 | Ga0466706_195965 | 3300042599 | Bacteria | 1073 |
| 32 | Ga0466707_409501 | 3300042601 | Bacteria | 1911 |
| 33 | Ga0466716_484837 | 3300042605 | Bacteria | 30730 |
| 34 | Ga0466719_119717 | 3300042606 | Bacteria | 17932 |
| 35 | Ga0466722_138448 | 3300042609 | Bacteria | 6032 |
| 36 | Ga0466722_156135 | 3300042609 | Bacteria | 6286 |
| 37 | Ga0466735_233477 | 3300042624 | Bacteria | 1560 |
| 38 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 39 | Ga0466703_202519 | 3300042636 | Bacteria | 22773 |
| 40 | Ga0466709_204908 | 3300042648 | Bacteria | 5360 |
| 41 | Ga0466708_066300 | 3300042652 | Bacteria | 36627 |
| 42 | Ga0466656_176815 | 3300042550 | Bacteria | 2267 |
| 43 | Ga0466657_072121 | 3300042582 | Bacteria | 9488 |
| 44 | Ga0466657_168532 | 3300042582 | Bacteria | 9954 |
| 45 | Ga0466657_308384 | 3300042582 | Bacteria | 1019 |
| 46 | Ga0466690_039968 | 3300042590 | Bacteria | 9494 |
| 47 | Ga0466690_150289 | 3300042590 | Bacteria | 55221 |
| 48 | Ga0466690_416236 | 3300042590 | Unclassified | 2081 |
| 49 | Ga0466691_127886 | 3300042593 | Bacteria | 16442 |
| 50 | Ga0466696_061891 | 3300042596 | Bacteria | 14268 |
| 51 | Ga0466696_215903 | 3300042596 | Bacteria | 16708 |
| 52 | Ga0466705_077990 | 3300042612 | Bacteria | 24079 |
| 53 | 2227279693 | 2225789004 | Bacteria | 1262 |
| 54 | IMNBL1DRAFT_c0052490 | 3300000062 | Bacteria | 1277 |
| 55 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 56 | JGI24696J40584_12958633 | 3300002834 | Bacteria | 4282 |
| 57 | Ga0466711_285989 | 3300042615 | Bacteria | 7430 |
| 58 | Ga0466715_204293 | 3300042616 | Bacteria | 67582 |
| 59 | Ga0466715_273928 | 3300042616 | Bacteria | 5514 |
| 60 | Ga0466713_077495 | 3300042602 | Bacteria | 42226 |
| 61 | Ga0466716_485727 | 3300042605 | Bacteria | 6567 |
| 62 | Ga0466735_055308 | 3300042624 | Unclassified | 1181 |
| 63 | Ga0466735_129784 | 3300042624 | Unclassified | 4597 |
| 64 | Ga0466735_130732 | 3300042624 | Bacteria | 1034 |
| 65 | Ga0466703_237479 | 3300042636 | Bacteria | 23006 |
| 66 | Ga0466708_372311 | 3300042652 | Bacteria | 12035 |
| 67 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 68 | Ga0466656_238755 | 3300042550 | Bacteria | 1691 |
| 69 | Ga0466696_285690 | 3300042596 | Unclassified | 2965 |
| 70 | Ga0466733_048728 | 3300042659 | Bacteria | 24602 |
| 71 | 2227358582 | 2225789004 | Bacteria | 27844 |
| 72 | JGI24702J35022_10448563 | 3300002462 | Bacteria | 785 |
| 73 | Ga0068302_10120824 | 3300005071 | Unclassified | 1981 |
| 74 | Ga0068305_10029560 | 3300005083 | Bacteria | 6769 |
| 75 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 76 | Ga0466706_095663 | 3300042599 | Bacteria | 79833 |
| 77 | Ga0466704_046663 | 3300042643 | Bacteria | 1697 |
| 78 | Ga0466704_157382 | 3300042643 | Bacteria | 6620 |
| 79 | Ga0466725_383969 | 3300042654 | Bacteria | 7339 |
| 80 | Ga0466727_165399 | 3300042655 | Bacteria | 2838 |
| 81 | Ga0466690_425264 | 3300042590 | Bacteria | 16300 |
| 82 | Ga0466696_052384 | 3300042596 | Bacteria | 2171 |
| 83 | Ga0466699_096967 | 3300042597 | Bacteria | 5112 |
| 84 | 2227546306 | 2225789004 | Bacteria | 2914 |
| 85 | JGI24702J35022_10004055 | 3300002462 | Bacteria | 8770 |
| 86 | Ga0466706_013314 | 3300042599 | Bacteria | 67982 |
| 87 | Ga0466713_047540 | 3300042602 | Bacteria | 17647 |
| 88 | Ga0466716_025191 | 3300042605 | Bacteria | 12762 |
| 89 | Ga0466735_008892 | 3300042624 | Bacteria | 2153 |
| 90 | Ga0466735_064671 | 3300042624 | Bacteria | 78203 |
| 91 | Ga0466735_178990 | 3300042624 | Bacteria | 1355 |
| 92 | Ga0466704_287104 | 3300042643 | Bacteria | 2026 |
| 93 | Ga0466696_123817 | 3300042596 | Unclassified | 2070 |
| 94 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 95 | Ga0466732_178024 | 3300042656 | Bacteria | 2808 |
| 96 | 2227180794 | 2225789004 | Bacteria | 8074 |
| 97 | IMNBL1DRAFT_c0092041 | 3300000062 | Bacteria | 829 |
| 98 | Ga0068305_10212060 | 3300005083 | Bacteria | 3027 |
| 99 | Ga0466705_490633 | 3300042612 | Bacteria | 3338 |
| 100 | Ga0466711_265420 | 3300042615 | Bacteria | 8423 |
| 101 | Ga0466711_398384 | 3300042615 | Bacteria | 15110 |
| 102 | Ga0466723_217618 | 3300042618 | Bacteria | 13477 |
| 103 | Ga0466706_037096 | 3300042599 | Bacteria | 1203 |
| 104 | Ga0466706_064281 | 3300042599 | Unclassified | 4414 |
| 105 | Ga0466706_259531 | 3300042599 | Bacteria | 16194 |
| 106 | Ga0466707_027552 | 3300042601 | Bacteria | 3394 |
| 107 | Ga0466735_031635 | 3300042624 | Bacteria | 1522 |
| 108 | Ga0466735_235509 | 3300042624 | Bacteria | 1278 |
| 109 | Ga0466704_054809 | 3300042643 | Bacteria | 13922 |
| 110 | Ga0466704_080074 | 3300042643 | Bacteria | 18633 |
| 111 | Ga0466709_101953 | 3300042648 | Bacteria | 13846 |
| 112 | Ga0466709_285899 | 3300042648 | Bacteria | 8774 |
| 113 | Ga0466727_188438 | 3300042655 | Bacteria | 2995 |
| 114 | Ga0466657_217982 | 3300042582 | Bacteria | 10357 |
| 115 | Ga0466696_153010 | 3300042596 | Unclassified | 3046 |
| 116 | Ga0466733_002151 | 3300042659 | Bacteria | 71476 |
| 117 | 2227481040 | 2225789004 | Bacteria | 4435 |
| 118 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 119 | Ga0068305_10001726 | 3300005083 | Bacteria | 19625 |
| 120 | Ga0072941_1589607 | 3300005201 | Bacteria | 1685 |
| 121 | Ga0466710_388454 | 3300042613 | Bacteria | 7193 |
| 122 | Ga0466715_376227 | 3300042616 | Bacteria | 52075 |
| 123 | Ga0466728_082650 | 3300042620 | Bacteria | 29100 |
| 124 | Ga0466728_107128 | 3300042620 | Bacteria | 57029 |
| 125 | Ga0466728_122860 | 3300042620 | Bacteria | 67185 |
| 126 | Ga0466706_232032 | 3300042599 | Bacteria | 12970 |
| 127 | Ga0466707_121528 | 3300042601 | Bacteria | 7706 |
| 128 | Ga0466713_037887 | 3300042602 | Bacteria | 30344 |
| 129 | Ga0466735_019058 | 3300042624 | Unclassified | 1323 |
| 130 | Ga0466735_104930 | 3300042624 | Unclassified | 3898 |
| 131 | Ga0466703_209026 | 3300042636 | Bacteria | 32874 |
| 132 | Ga0466704_461780 | 3300042643 | Unclassified | 6524 |
| 133 | Ga0466724_60298 | 3300042649 | Bacteria | 3736 |
| 134 | Ga0466727_068059 | 3300042655 | Bacteria | 5782 |
| 135 | Ga0466690_389175 | 3300042590 | Bacteria | 15062 |
| 136 | Ga0466696_014642 | 3300042596 | Bacteria | 5725 |
| 137 | Ga0466696_022332 | 3300042596 | Bacteria | 1952 |
| 138 | Ga0466705_128961 | 3300042612 | Bacteria | 4737 |
| 139 | IMNBL1DRAFT_c0003067 | 3300000062 | Unclassified | 11030 |
| 140 | JGI24702J35022_10763393 | 3300002462 | Bacteria | 602 |
| 141 | Ga0068302_10055682 | 3300005071 | Unclassified | 7052 |
| 142 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 143 | Ga0466711_218034 | 3300042615 | Bacteria | 4023 |
| 144 | Ga0466715_106265 | 3300042616 | Bacteria | 12571 |
| 145 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 146 | Ga0466726_048838 | 3300042619 | Bacteria | 2233 |
| 147 | Ga0466706_103796 | 3300042599 | Bacteria | 26141 |
| 148 | Ga0466706_153835 | 3300042599 | Unclassified | 1339 |
| 149 | Ga0466706_265429 | 3300042599 | Bacteria | 13406 |
| 150 | Ga0466713_084099 | 3300042602 | Bacteria | 3042 |
| 151 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 152 | Ga0466722_139050 | 3300042609 | Bacteria | 1002 |
| 153 | Ga0466703_001595 | 3300042636 | Bacteria | 18307 |
| 154 | Ga0466704_247905 | 3300042643 | Bacteria | 30308 |
| 155 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 156 | Ga0466727_070045 | 3300042655 | Bacteria | 1501 |
| 157 | Ga0466727_179059 | 3300042655 | Bacteria | 12208 |
| 158 | Ga0466656_028592 | 3300042550 | Bacteria | 1333 |
| 159 | Ga0466690_305294 | 3300042590 | Bacteria | 13677 |
| 160 | Ga0466693_277047 | 3300042592 | Bacteria | 1450 |
| 161 | Ga0466691_118162 | 3300042593 | Unclassified | 1172 |
| 162 | Ga0466696_300751 | 3300042596 | Bacteria | 1603 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 22 | 160 | 0.78 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.