Protein Family IF00808

Metagenome Isolate
152 Members
73 Samples
124 Scaffolds
251.39 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10051644|JGI24702J35022_100516442
Length
275 aa
Sequence
LLGRKKKLSCREXKSIMRLYMKFFSMHLKSQMQYKTSFFLTMFGQFLVSFTAFLGVYFMFSRFDAVEGYAFEQALLCYAVVLVAFSTAEMLGRGFDLFPRMIQSGEFDRVLVRPKNVIFQVLASKMDFTRLGRLFQATVVFCYAIPNSGVNWTPDKILTLCLMVVCGSLIFFGLFLVYAAFSFFTIEGLEFMNVFTDGGREFGRYPFSVYGKNILMFLTFVIPLALFQYYPLLYLLDREQSVFFMFLPLVGLLFLVPSYVFFRVGLRRYTSTGS*

📊 Sample Types

Isolate 18.4%
Metagenome 81.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.6%
Termitidae 34.3%
Kalotermitidae 12.9%
Rhinotermitidae 4.3%
Tenebrionidae 4.3%
Passalidae 2.9%
Vespidae 1.4%
Scarabaeidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
3 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
4 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
5 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
6 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
9 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
16 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
17 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
18 2820072841 Unclassified Proteobacteria Nt197P3bin127 Isolate Unclassified
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
28 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
29 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
30 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
31 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
32 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
35 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
45 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
46 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
51 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
52 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
53 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
63 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
64 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
65 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
66 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
72 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
73 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0092 3300056790 Bacteria 317609
2 JGI24695J34938_10048506 3300002450 Bacteria 1870
3 JGI24702J35022_10009084 3300002462 Bacteria 5599
4 JGI24702J35022_10030735 3300002462 Bacteria 2881
5 JGI24702J35022_10064942 3300002462 Bacteria 1958
6 Ga0068305_10002300 3300005083 Bacteria 37253
7 Ga0072941_1000468 3300005201 Bacteria 5957
8 Ga0072941_1000469 3300005201 Unclassified 3061
9 Ga0466718_169460 3300042617 Bacteria 1435
10 Ga0466729_013325 3300042621 Bacteria 2184
11 Ga0123355_10163441 3300009826 Bacteria 3347
12 Ga0123355_10380446 3300009826 Bacteria 1840
13 Ga0123356_10761253 3300010049 Bacteria 1139
14 Ga0123353_10023044 3300010167 Bacteria 9414
15 Ga0123353_10506783 3300010167 Bacteria 1756
16 Ga0466693_443998 3300042592 Bacteria 1545
17 Ga0466699_196405 3300042597 Bacteria 3566
18 Ga0466700_226234 3300042600 Bacteria 1642
19 Ga0466700_469769 3300042600 Bacteria 1570
20 Ga0466704_020045 3300042643 Bacteria 3477
21 Ga0466704_526762 3300042643 Bacteria 2883
22 Ga0466733_008715 3300042659 Bacteria 1297
23 2227588797 2225789004 Bacteria 2442
24 Ga0072941_1044882 3300005201 Bacteria 2125
25 Ga0466729_087762 3300042621 Bacteria 1260
26 Ga0123356_10017513 3300010049 Bacteria 6816
27 Ga0123356_10050902 3300010049 Bacteria 3853
28 Ga0123356_10199345 3300010049 Bacteria 2040
29 Ga0123356_10206550 3300010049 Unclassified 2008
30 Ga0123356_10310209 3300010049 Bacteria 1686
31 Ga0123353_10632799 3300010167 Unclassified 1520
32 Ga0466713_065300 3300042602 Bacteria 1174
33 Ga0466714_053105 3300042603 Bacteria 1892
34 Ga0466724_23477 3300042649 Bacteria 4222
35 IMNBL1DRAFT_c0000021 3300000062 Bacteria 148886
36 Ga0072941_1033578 3300005201 Bacteria 4583
37 Ga0123357_10037814 3300009784 Bacteria 6570
38 Ga0123355_10016922 3300009826 Bacteria 11503
39 Ga0123356_10000262 3300010049 Bacteria 60769
40 Ga0123356_10264490 3300010049 Bacteria 1806
41 Ga0123353_10001599 3300010167 Bacteria 27891
42 Ga0123353_10154773 3300010167 Bacteria 3656
43 Ga0123353_10179356 3300010167 Bacteria 3355
44 Ga0123353_10384437 3300010167 Bacteria 2098
45 Ga0466693_402206 3300042592 Bacteria 20058
46 Ga0466713_122316 3300042602 Bacteria 7595
47 Ga0466714_060578 3300042603 Bacteria 1194
48 Ga0466722_102990 3300042609 Bacteria 2797
49 Ga0466734_075402 3300042623 Bacteria 1187
50 Ga0466708_443532 3300042652 Bacteria 3666
51 JGI24695J34938_10000267 3300002450 Bacteria 50738
52 JGI24702J35022_10010650 3300002462 Bacteria 5137
53 JGI24697J35500_11224257 3300002507 Bacteria 1932
54 Ga0123357_10203112 3300009784 Bacteria 2249
55 Ga0123355_10000607 3300009826 Bacteria 48372
56 Ga0123356_10003321 3300010049 Bacteria 16883
57 Ga0123353_10203808 3300010167 Bacteria 3109
58 Ga0123353_10586241 3300010167 Bacteria 1598
59 Ga0160441_100316 3300012825 Bacteria 43612
60 Ga0466692_101006 3300042591 Bacteria 1471
61 Ga0466694_405209 3300042594 Bacteria 5468
62 Ga0466714_026296 3300042603 Bacteria 18081
63 Ga0466697_004429 3300042611 Bacteria 2971
64 Ga0466705_239567 3300042612 Bacteria 3692
65 Ga0072941_1050903 3300005201 Unclassified 6249
66 Ga0466711_233007 3300042615 Bacteria 3925
67 Ga0466715_429206 3300042616 Bacteria 39560
68 Ga0123356_10003381 3300010049 Bacteria 16737
69 Ga0123356_10096126 3300010049 Bacteria 2832
70 Ga0123356_10118905 3300010049 Bacteria 2566
71 Ga0123353_10000925 3300010167 Bacteria 35824
72 Ga0123353_10044079 3300010167 Bacteria 7071
73 Ga0123353_10369088 3300010167 Bacteria 2153
74 Ga0123353_10492989 3300010167 Bacteria 1788
75 Ga0123353_10978524 3300010167 Bacteria 1140
76 Ga0466714_001358 3300042603 Bacteria 1176
77 Ga0466714_045116 3300042603 Bacteria 3700
78 Ga0466731_053035 3300042622 Bacteria 4612
79 Ga0562378_0193 3300056814 Bacteria 149270
80 JGI24695J34938_10004699 3300002450 Bacteria 8848
81 Ga0123356_10035636 3300010049 Bacteria 4647
82 Ga0123353_10064671 3300010167 Bacteria 5871
83 Ga0123353_10415073 3300010167 Bacteria 1997
84 Ga0415639_072191 3300038395 Bacteria 1903
85 Ga0466696_314208 3300042596 Bacteria 1576
86 Ga0466707_304216 3300042601 Bacteria 12242
87 Ga0466714_032719 3300042603 Bacteria 4212
88 Ga0466714_132839 3300042603 Bacteria 4250
89 Ga0466717_204066 3300042604 Bacteria 2545
90 Ga0466721_168866 3300042608 Bacteria 2482
91 Ga0466703_145380 3300042636 Bacteria 7606
92 Ga0466709_240899 3300042648 Bacteria 33424
93 Ga0466724_56697 3300042649 Bacteria 2511
94 JGI24695J34938_10000701 3300002450 Bacteria 31525
95 JGI24702J35022_10016178 3300002462 Bacteria 4093
96 Ga0466705_421583 3300042612 Bacteria 20644
97 Ga0466715_295640 3300042616 Unclassified 169413
98 Ga0123355_10344149 3300009826 Bacteria 1983
99 Ga0123353_10136036 3300010167 Bacteria 3941
100 Ga0123353_10797981 3300010167 Unclassified 1304
101 Ga0415639_059900 3300038395 Bacteria 7859
102 Ga0466714_118974 3300042603 Bacteria 3358
103 Ga0466722_136743 3300042609 Bacteria 57023
104 Ga0466704_551580 3300042643 Bacteria 1539
105 Ga0466697_073743 3300042611 Bacteria 1057
106 Ga0466705_306648 3300042612 Bacteria 5175
107 Ga0562375_3733 3300056856 Bacteria 13445
108 2227191897 2225789004 Bacteria 34717
109 2227657958 2225789004 Bacteria 10578
110 JGI24695J34938_10066246 3300002450 Bacteria 1523
111 JGI24702J35022_10000169 3300002462 Bacteria 34308
112 JGI24702J35022_10051644 3300002462 Bacteria 2191
113 Ga0072941_1045122 3300005201 Bacteria 7766
114 Ga0466718_029414 3300042617 Archaea 1504
115 Ga0123357_10421814 3300009784 Bacteria 1189
116 Ga0123355_10000537 3300009826 Bacteria 50831
117 Ga0123355_10122270 3300009826 Bacteria 4034
118 Ga0123356_10054334 3300010049 Bacteria 3730
119 Ga0123356_10283279 3300010049 Bacteria 1754
120 Ga0123353_11564932 3300010167 Bacteria 835
121 Ga0123354_10481548 3300010882 Bacteria 981
122 Ga0466656_371573 3300042550 Bacteria 1759
123 Ga0466713_059062 3300042602 Bacteria 88440
124 Ga0466719_226791 3300042606 Bacteria 6608

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06182 ABC2_membrane_6 ABC-2 family transporter protein 47 273 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.