Protein Family IF00788
Metagenome
Isolate
287
Members
62
Samples
280
Scaffolds
104.22
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10014118|JGI24702J35022_100141182
- Length
- 125 aa
- Sequence
- MIQYYINNCNTFFPFYINTDIAMDLERLVIDNIKRIRKEKGFTQEKLAEACDTATSYIGLMEIYRNIPKLSTIEKIAQALSVDPLIFFKEFNKFSTEQENEIHEKKQKILTVLDKEIDLILHDK*
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Kalotermitidae
23.3%
Unclassified
15.0%
Rhinotermitidae
6.7%
Termopsidae
5.0%
Blaberidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
2
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
67
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 47 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 61 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 62 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_217937 | 3300042656 | Bacteria | 1234 |
| 2 | Ga0456237_0027329 | 3300041968 | Bacteria | 773 |
| 3 | Ga0466690_128109 | 3300042590 | Bacteria | 1783 |
| 4 | Ga0466692_070719 | 3300042591 | Bacteria | 1598 |
| 5 | Ga0466693_030426 | 3300042592 | Bacteria | 53020 |
| 6 | Ga0466699_427681 | 3300042597 | Bacteria | 1108 |
| 7 | Ga0466699_437211 | 3300042597 | Unclassified | 1424 |
| 8 | JGI24698J34947_10025372 | 3300002449 | Bacteria | 3156 |
| 9 | JGI24695J34938_10000388 | 3300002450 | Bacteria | 43510 |
| 10 | JGI24695J34938_10005343 | 3300002450 | Bacteria | 8034 |
| 11 | JGI24697J35500_11042721 | 3300002507 | Unclassified | 1022 |
| 12 | JGI24699J35502_10987629 | 3300002509 | Bacteria | 1297 |
| 13 | Ga0072941_1064602 | 3300005201 | Bacteria | 2909 |
| 14 | Ga0466702_131831 | 3300042635 | Bacteria | 2814 |
| 15 | Ga0466704_129243 | 3300042643 | Bacteria | 1345 |
| 16 | Ga0466704_370557 | 3300042643 | Bacteria | 4570 |
| 17 | Ga0466727_040889 | 3300042655 | Bacteria | 1053 |
| 18 | Ga0466727_146149 | 3300042655 | Bacteria | 1216 |
| 19 | Ga0466727_171043 | 3300042655 | Bacteria | 1537 |
| 20 | Ga0466727_247104 | 3300042655 | Bacteria | 1034 |
| 21 | Ga0466727_264304 | 3300042655 | Bacteria | 2938 |
| 22 | Ga0466712_019696 | 3300042614 | Unclassified | 1177 |
| 23 | Ga0466712_089450 | 3300042614 | Unclassified | 4730 |
| 24 | Ga0466711_401509 | 3300042615 | Bacteria | 2316 |
| 25 | Ga0466718_152397 | 3300042617 | Bacteria | 2673 |
| 26 | Ga0466723_033329 | 3300042618 | Unclassified | 3560 |
| 27 | Ga0466707_255560 | 3300042601 | Bacteria | 1019 |
| 28 | Ga0466719_018863 | 3300042606 | Bacteria | 4678 |
| 29 | Ga0466719_136070 | 3300042606 | Bacteria | 2983 |
| 30 | Ga0123356_10101280 | 3300010049 | Bacteria | 2763 |
| 31 | Ga0123353_11384956 | 3300010167 | Unclassified | 905 |
| 32 | Ga0123353_11898914 | 3300010167 | Unclassified | 735 |
| 33 | Ga0466690_063289 | 3300042590 | Bacteria | 4888 |
| 34 | Ga0466690_233673 | 3300042590 | Bacteria | 2215 |
| 35 | Ga0466692_187188 | 3300042591 | Bacteria | 1360 |
| 36 | Ga0466693_416155 | 3300042592 | Bacteria | 3563 |
| 37 | Ga0466691_008908 | 3300042593 | Bacteria | 5397 |
| 38 | Ga0466694_003794 | 3300042594 | Unclassified | 1121 |
| 39 | Ga0466694_187053 | 3300042594 | Bacteria | 2779 |
| 40 | Ga0466699_140422 | 3300042597 | Bacteria | 1062 |
| 41 | AustNasuHG_c1017189 | 3300000089 | Bacteria | 2410 |
| 42 | JGI24698J34947_10005065 | 3300002449 | Bacteria | 7217 |
| 43 | JGI24698J34947_10005513 | 3300002449 | Bacteria | 6943 |
| 44 | JGI24698J34947_10011649 | 3300002449 | Bacteria | 4828 |
| 45 | JGI24698J34947_10028839 | 3300002449 | Bacteria | 2937 |
| 46 | JGI24698J34947_10057682 | 3300002449 | Bacteria | 1925 |
| 47 | JGI24698J34947_10083366 | 3300002449 | Unclassified | 1492 |
| 48 | JGI24698J34947_10106391 | 3300002449 | Unclassified | 1248 |
| 49 | Ga0466703_253997 | 3300042636 | Bacteria | 12715 |
| 50 | Ga0466704_052514 | 3300042643 | Bacteria | 70505 |
| 51 | Ga0466704_103338 | 3300042643 | Bacteria | 4267 |
| 52 | Ga0466727_096451 | 3300042655 | Bacteria | 1358 |
| 53 | Ga0466711_181349 | 3300042615 | Bacteria | 1975 |
| 54 | Ga0466718_131235 | 3300042617 | Unclassified | 1010 |
| 55 | Ga0466723_366358 | 3300042618 | Bacteria | 2080 |
| 56 | Ga0466726_258880 | 3300042619 | Bacteria | 7107 |
| 57 | Ga0466726_279138 | 3300042619 | Bacteria | 1888 |
| 58 | Ga0466726_299186 | 3300042619 | Bacteria | 25856 |
| 59 | Ga0466728_308649 | 3300042620 | Bacteria | 6240 |
| 60 | Ga0466713_034229 | 3300042602 | Bacteria | 1725 |
| 61 | Ga0466719_056383 | 3300042606 | Bacteria | 1271 |
| 62 | Ga0466719_497597 | 3300042606 | Bacteria | 1701 |
| 63 | Ga0466720_192930 | 3300042607 | Unclassified | 1752 |
| 64 | Ga0466722_009665 | 3300042609 | Bacteria | 26209 |
| 65 | Ga0466698_044977 | 3300042610 | Unclassified | 1198 |
| 66 | Ga0466698_149643 | 3300042610 | Bacteria | 2279 |
| 67 | Ga0123357_10726989 | 3300009784 | Unclassified | 700 |
| 68 | Ga0123354_10427216 | 3300010882 | Bacteria | 1095 |
| 69 | Ga0466732_089157 | 3300042656 | Bacteria | 1962 |
| 70 | Ga0264413_109683 | 3300024493 | Bacteria | 1868 |
| 71 | Ga0466692_180334 | 3300042591 | Bacteria | 1173 |
| 72 | Ga0466691_109493 | 3300042593 | Bacteria | 23172 |
| 73 | Ga0466694_106100 | 3300042594 | Unclassified | 3755 |
| 74 | Ga0466694_114814 | 3300042594 | Unclassified | 5726 |
| 75 | Ga0466699_017913 | 3300042597 | Bacteria | 1245 |
| 76 | Ga0466699_097442 | 3300042597 | Bacteria | 2463 |
| 77 | JGI24702J35022_10105566 | 3300002462 | Unclassified | 1545 |
| 78 | Ga0466729_249174 | 3300042621 | Bacteria | 1108 |
| 79 | Ga0466731_127080 | 3300042622 | Bacteria | 1018 |
| 80 | Ga0466704_324468 | 3300042643 | Bacteria | 2030 |
| 81 | Ga0466704_451863 | 3300042643 | Bacteria | 1310 |
| 82 | Ga0466709_259101 | 3300042648 | Bacteria | 5604 |
| 83 | Ga0466709_347584 | 3300042648 | Unclassified | 1177 |
| 84 | Ga0466708_052746 | 3300042652 | Bacteria | 3590 |
| 85 | Ga0466727_202826 | 3300042655 | Bacteria | 21540 |
| 86 | Ga0466727_231701 | 3300042655 | Bacteria | 1180 |
| 87 | Ga0466705_495066 | 3300042612 | Unclassified | 1300 |
| 88 | Ga0466726_079435 | 3300042619 | Bacteria | 1508 |
| 89 | Ga0466726_329814 | 3300042619 | Bacteria | 1750 |
| 90 | Ga0466716_355720 | 3300042605 | Bacteria | 5852 |
| 91 | Ga0466719_033472 | 3300042606 | Bacteria | 4400 |
| 92 | Ga0466719_036158 | 3300042606 | Unclassified | 4747 |
| 93 | Ga0123356_10114768 | 3300010049 | Bacteria | 2609 |
| 94 | Ga0123356_11296473 | 3300010049 | Unclassified | 892 |
| 95 | Ga0123356_14007378 | 3300010049 | Bacteria | 507 |
| 96 | Ga0123353_11105539 | 3300010167 | Unclassified | 1052 |
| 97 | Ga0466732_227103 | 3300042656 | Bacteria | 1045 |
| 98 | Ga0466733_003268 | 3300042659 | Bacteria | 1038 |
| 99 | Ga0466692_087581 | 3300042591 | Unclassified | 8679 |
| 100 | Ga0466691_219039 | 3300042593 | Bacteria | 5841 |
| 101 | Ga0466699_079858 | 3300042597 | Bacteria | 5370 |
| 102 | Ga0466699_087231 | 3300042597 | Bacteria | 1085 |
| 103 | AustNasuHG_c1011114 | 3300000089 | Bacteria | 3123 |
| 104 | AustNasuHG_c1016269 | 3300000089 | Bacteria | 2491 |
| 105 | JGI24698J34947_10055727 | 3300002449 | Bacteria | 1968 |
| 106 | JGI24698J34947_10090325 | 3300002449 | Unclassified | 1407 |
| 107 | JGI24698J34947_10146227 | 3300002449 | Unclassified | 988 |
| 108 | JGI24696J40584_12391221 | 3300002834 | Bacteria | 551 |
| 109 | JGI24696J40584_12584492 | 3300002834 | Bacteria | 646 |
| 110 | Ga0072940_1027904 | 3300005200 | Bacteria | 4332 |
| 111 | Ga0072940_1156937 | 3300005200 | Unclassified | 797 |
| 112 | Ga0466703_029533 | 3300042636 | Bacteria | 4038 |
| 113 | Ga0466709_347911 | 3300042648 | Bacteria | 7771 |
| 114 | Ga0466708_291525 | 3300042652 | Bacteria | 19495 |
| 115 | Ga0466712_076743 | 3300042614 | Bacteria | 9313 |
| 116 | Ga0466712_257630 | 3300042614 | Bacteria | 11905 |
| 117 | Ga0466711_010584 | 3300042615 | Bacteria | 3405 |
| 118 | Ga0466715_578415 | 3300042616 | Bacteria | 7956 |
| 119 | Ga0466718_006791 | 3300042617 | Bacteria | 6939 |
| 120 | Ga0466718_074522 | 3300042617 | Unclassified | 3096 |
| 121 | Ga0466718_164588 | 3300042617 | Bacteria | 1143 |
| 122 | Ga0466726_429061 | 3300042619 | Bacteria | 3059 |
| 123 | Ga0466729_027141 | 3300042621 | Bacteria | 7552 |
| 124 | Ga0466729_069801 | 3300042621 | Bacteria | 1541 |
| 125 | Ga0466707_209008 | 3300042601 | Bacteria | 1430 |
| 126 | Ga0466707_400684 | 3300042601 | Bacteria | 28066 |
| 127 | Ga0466720_066916 | 3300042607 | Bacteria | 11333 |
| 128 | Ga0123357_10163471 | 3300009784 | Bacteria | 2660 |
| 129 | Ga0123357_10264293 | 3300009784 | Bacteria | 1812 |
| 130 | Ga0123356_10011765 | 3300010049 | Bacteria | 8516 |
| 131 | Ga0466705_164725 | 3300042612 | Unclassified | 4265 |
| 132 | Ga0466705_267823 | 3300042612 | Unclassified | 10261 |
| 133 | Ga0466690_263645 | 3300042590 | Unclassified | 1263 |
| 134 | Ga0466692_128669 | 3300042591 | Bacteria | 1145 |
| 135 | AustNasuHG_c1014617 | 3300000089 | Bacteria | 2663 |
| 136 | JGI24698J34947_10004627 | 3300002449 | Bacteria | 7501 |
| 137 | JGI24698J34947_10006431 | 3300002449 | Bacteria | 6448 |
| 138 | JGI24698J34947_10298552 | 3300002449 | Unclassified | 581 |
| 139 | JGI24702J35022_10014118 | 3300002462 | Unclassified | 4412 |
| 140 | JGI24697J35500_11253845 | 3300002507 | Bacteria | 2639 |
| 141 | Ga0072941_1018186 | 3300005201 | Archaea | 6390 |
| 142 | Ga0072941_1351769 | 3300005201 | Unclassified | 1037 |
| 143 | Ga0466731_184863 | 3300042622 | Archaea | 1274 |
| 144 | Ga0466709_228980 | 3300042648 | Bacteria | 11534 |
| 145 | Ga0466727_087631 | 3300042655 | Bacteria | 1229 |
| 146 | Ga0466712_029993 | 3300042614 | Unclassified | 1000 |
| 147 | Ga0466712_098039 | 3300042614 | Bacteria | 7033 |
| 148 | Ga0466712_098058 | 3300042614 | Bacteria | 19790 |
| 149 | Ga0466712_107052 | 3300042614 | Unclassified | 22415 |
| 150 | Ga0466715_153810 | 3300042616 | Bacteria | 1659 |
| 151 | Ga0466715_549449 | 3300042616 | Bacteria | 11496 |
| 152 | Ga0466718_026240 | 3300042617 | Bacteria | 37188 |
| 153 | Ga0466726_239516 | 3300042619 | Bacteria | 17382 |
| 154 | Ga0466728_061937 | 3300042620 | Bacteria | 2826 |
| 155 | Ga0466728_295382 | 3300042620 | Bacteria | 4782 |
| 156 | Ga0466729_062452 | 3300042621 | Bacteria | 3467 |
| 157 | Ga0466707_289441 | 3300042601 | Bacteria | 1540 |
| 158 | Ga0466717_257266 | 3300042604 | Bacteria | 2632 |
| 159 | Ga0466720_089845 | 3300042607 | Bacteria | 10496 |
| 160 | Ga0466698_158571 | 3300042610 | Unclassified | 1026 |
| 161 | Ga0123356_10066153 | 3300010049 | Bacteria | 3383 |
| 162 | Ga0123356_10163766 | 3300010049 | Unclassified | 2225 |
| 163 | Ga0123356_11050674 | 3300010049 | Unclassified | 984 |
| 164 | Ga0123356_11867704 | 3300010049 | Bacteria | 748 |
| 165 | Ga0123356_12268326 | 3300010049 | Unclassified | 679 |
| 166 | Ga0466733_022507 | 3300042659 | Bacteria | 4634 |
| 167 | Ga0415639_078119 | 3300038395 | Unclassified | 1850 |
| 168 | Ga0466692_056609 | 3300042591 | Bacteria | 2170 |
| 169 | Ga0466691_226762 | 3300042593 | Bacteria | 2981 |
| 170 | Ga0466694_181079 | 3300042594 | Unclassified | 1008 |
| 171 | JGI24698J34947_10053006 | 3300002449 | Bacteria | 2032 |
| 172 | JGI24698J34947_10080110 | 3300002449 | Bacteria | 1535 |
| 173 | JGI24698J34947_10245936 | 3300002449 | Unclassified | 671 |
| 174 | JGI24695J34938_10001333 | 3300002450 | Bacteria | 21335 |
| 175 | JGI24695J34938_10221265 | 3300002450 | Unclassified | 795 |
| 176 | Ga0072940_1008637 | 3300005200 | Unclassified | 4508 |
| 177 | Ga0072941_1007187 | 3300005201 | Bacteria | 9105 |
| 178 | Ga0466735_079555 | 3300042624 | Bacteria | 1148 |
| 179 | Ga0466702_084406 | 3300042635 | Bacteria | 1017 |
| 180 | Ga0466708_034883 | 3300042652 | Bacteria | 1048 |
| 181 | Ga0466727_271834 | 3300042655 | Bacteria | 5328 |
| 182 | Ga0466712_007572 | 3300042614 | Bacteria | 1287 |
| 183 | Ga0466712_076949 | 3300042614 | Bacteria | 1887 |
| 184 | Ga0466711_274299 | 3300042615 | Bacteria | 25725 |
| 185 | Ga0466726_217622 | 3300042619 | Bacteria | 6948 |
| 186 | Ga0466726_412712 | 3300042619 | Bacteria | 1587 |
| 187 | Ga0466726_449104 | 3300042619 | Bacteria | 1913 |
| 188 | Ga0466728_288732 | 3300042620 | Unclassified | 1028 |
| 189 | Ga0466707_211911 | 3300042601 | Bacteria | 1474 |
| 190 | Ga0466707_215861 | 3300042601 | Bacteria | 1561 |
| 191 | Ga0466719_240385 | 3300042606 | Bacteria | 1602 |
| 192 | Ga0466719_276755 | 3300042606 | Bacteria | 2072 |
| 193 | Ga0466720_072156 | 3300042607 | Bacteria | 2848 |
| 194 | Ga0466722_154573 | 3300042609 | Bacteria | 5072 |
| 195 | Ga0123357_10205706 | 3300009784 | Bacteria | 2227 |
| 196 | Ga0123356_10001080 | 3300010049 | Bacteria | 30215 |
| 197 | Ga0123356_11720911 | 3300010049 | Unclassified | 778 |
| 198 | Ga0123353_10028417 | 3300010167 | Bacteria | 8593 |
| 199 | Ga0466705_071594 | 3300042612 | Unclassified | 1498 |
| 200 | Ga0264413_124292 | 3300024493 | Unclassified | 1405 |
| 201 | Ga0466692_148609 | 3300042591 | Bacteria | 9657 |
| 202 | Ga0466694_119507 | 3300042594 | Bacteria | 2078 |
| 203 | Ga0466694_131079 | 3300042594 | Bacteria | 2903 |
| 204 | Ga0466696_071400 | 3300042596 | Bacteria | 1716 |
| 205 | Ga0466696_409767 | 3300042596 | Bacteria | 2642 |
| 206 | Ga0466699_100447 | 3300042597 | Bacteria | 1506 |
| 207 | Ga0466699_264499 | 3300042597 | Bacteria | 5466 |
| 208 | JGI24698J34947_10013482 | 3300002449 | Bacteria | 4463 |
| 209 | JGI24698J34947_10225453 | 3300002449 | Unclassified | 716 |
| 210 | JGI24695J34938_10024393 | 3300002450 | Bacteria | 2905 |
| 211 | JGI24702J35022_10654854 | 3300002462 | Unclassified | 652 |
| 212 | Ga0072941_1008436 | 3300005201 | Unclassified | 1408 |
| 213 | Ga0466702_459587 | 3300042635 | Bacteria | 3175 |
| 214 | Ga0466703_050375 | 3300042636 | Bacteria | 6731 |
| 215 | Ga0466704_104434 | 3300042643 | Bacteria | 1630 |
| 216 | Ga0466704_235838 | 3300042643 | Bacteria | 6338 |
| 217 | Ga0466704_451262 | 3300042643 | Bacteria | 1149 |
| 218 | Ga0466709_036536 | 3300042648 | Bacteria | 1640 |
| 219 | Ga0466708_204797 | 3300042652 | Bacteria | 2506 |
| 220 | Ga0466708_282110 | 3300042652 | Bacteria | 10940 |
| 221 | Ga0466727_324400 | 3300042655 | Bacteria | 1355 |
| 222 | Ga0466712_024419 | 3300042614 | Bacteria | 2965 |
| 223 | Ga0466712_151269 | 3300042614 | Bacteria | 20955 |
| 224 | Ga0466712_244238 | 3300042614 | Bacteria | 2114 |
| 225 | Ga0466711_319685 | 3300042615 | Bacteria | 10905 |
| 226 | Ga0466718_000035 | 3300042617 | Bacteria | 1896 |
| 227 | Ga0466718_081609 | 3300042617 | Bacteria | 1829 |
| 228 | Ga0466718_096278 | 3300042617 | Bacteria | 1170 |
| 229 | Ga0466723_254693 | 3300042618 | Bacteria | 2520 |
| 230 | Ga0466726_011977 | 3300042619 | Bacteria | 3048 |
| 231 | Ga0466706_092495 | 3300042599 | Bacteria | 6116 |
| 232 | Ga0466700_268774 | 3300042600 | Bacteria | 1732 |
| 233 | Ga0466707_187668 | 3300042601 | Bacteria | 1928 |
| 234 | Ga0466707_190655 | 3300042601 | Bacteria | 5988 |
| 235 | Ga0466707_363741 | 3300042601 | Bacteria | 2290 |
| 236 | Ga0466716_053459 | 3300042605 | Bacteria | 5839 |
| 237 | Ga0466719_091449 | 3300042606 | Bacteria | 8680 |
| 238 | Ga0466720_030096 | 3300042607 | Unclassified | 1934 |
| 239 | Ga0466720_138251 | 3300042607 | Bacteria | 1458 |
| 240 | Ga0466722_109842 | 3300042609 | Bacteria | 1892 |
| 241 | Ga0123355_11082960 | 3300009826 | Unclassified | 837 |
| 242 | Ga0123355_11226899 | 3300009826 | Unclassified | 762 |
| 243 | Ga0123356_12854380 | 3300010049 | Bacteria | 604 |
| 244 | Ga0466733_195301 | 3300042659 | Bacteria | 1677 |
| 245 | Ga0466692_140924 | 3300042591 | Unclassified | 6651 |
| 246 | Ga0466692_180217 | 3300042591 | Bacteria | 2442 |
| 247 | Ga0466694_079797 | 3300042594 | Unclassified | 2092 |
| 248 | Ga0466696_118652 | 3300042596 | Bacteria | 8384 |
| 249 | Ga0466699_172564 | 3300042597 | Unclassified | 2508 |
| 250 | Ga0466699_277434 | 3300042597 | Unclassified | 2622 |
| 251 | AustNasuHG_c1003123 | 3300000089 | Bacteria | 5970 |
| 252 | AustNasuHG_c1047290 | 3300000089 | Bacteria | 960 |
| 253 | JGI24698J34947_10001748 | 3300002449 | Bacteria | 11579 |
| 254 | JGI24698J34947_10005103 | 3300002449 | Bacteria | 7195 |
| 255 | JGI24698J34947_10014886 | 3300002449 | Bacteria | 4236 |
| 256 | JGI24698J34947_10018180 | 3300002449 | Unclassified | 3801 |
| 257 | JGI24698J34947_10102088 | 3300002449 | Bacteria | 1287 |
| 258 | JGI24695J34938_10004413 | 3300002450 | Bacteria | 9249 |
| 259 | JGI24703J35330_11016715 | 3300002501 | Unclassified | 641 |
| 260 | Ga0068305_10016901 | 3300005083 | Bacteria | 12649 |
| 261 | Ga0072941_1097308 | 3300005201 | Unclassified | 1092 |
| 262 | Ga0466735_148554 | 3300042624 | Unclassified | 1183 |
| 263 | Ga0466702_059723 | 3300042635 | Bacteria | 1774 |
| 264 | Ga0466703_076942 | 3300042636 | Bacteria | 6787 |
| 265 | Ga0466708_078587 | 3300042652 | Bacteria | 2482 |
| 266 | Ga0466727_288899 | 3300042655 | Bacteria | 1075 |
| 267 | Ga0466705_432279 | 3300042612 | Unclassified | 9427 |
| 268 | Ga0466711_246496 | 3300042615 | Bacteria | 8216 |
| 269 | Ga0466715_644753 | 3300042616 | Bacteria | 1614 |
| 270 | Ga0466718_010540 | 3300042617 | Bacteria | 3106 |
| 271 | Ga0466723_149337 | 3300042618 | Unclassified | 1030 |
| 272 | Ga0466707_392102 | 3300042601 | Bacteria | 1498 |
| 273 | Ga0466713_128603 | 3300042602 | Unclassified | 4722 |
| 274 | Ga0466717_290988 | 3300042604 | Bacteria | 1436 |
| 275 | Ga0466716_018776 | 3300042605 | Unclassified | 1348 |
| 276 | Ga0466716_229110 | 3300042605 | Bacteria | 5897 |
| 277 | Ga0466720_109512 | 3300042607 | Bacteria | 3395 |
| 278 | Ga0466720_131917 | 3300042607 | Bacteria | 1104 |
| 279 | Ga0466698_492330 | 3300042610 | Unclassified | 2982 |
| 280 | Ga0123353_10819539 | 3300010167 | Bacteria | 1281 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.