Protein Family IF00784

Metagenome Isolate
121 Members
54 Samples
101 Scaffolds
422.35 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10011770|JGI24702J35022_100117704
Length
469 aa
Sequence
MKPWDTNVTALNESSNNHLSLLELHTMIRETLQGTFPDTYWVRAEMSDLRVNAASGHCYLEFIEKDEKTGQTVAKARGTIWARTFHLLKPYFEKETKQAFTSGLKVLVNVSVEFHELYGYSLRVCDIDPSYTVGDLVRKRAEIVRRLQEEGIFNLNRELSFPVLPQRIAVITSPTAAGYEDFVRQLADNEYGFSFYIKLFPAIMQGDKTEESVIAAFDRIFLHSLHFDVVVLIRGGGSTAELSCFDSYLLAANCAQFPLPVITGIGHERDDTIVDMVAHTRMKTPTAVAAFLIERMTREAALIQEFEKAIYENVMKGLQQKKAVLQTLTARLPLTVSKHIEXHRKQLNKVTAFISTLPQWLYRCSEKLNELPPRLQRATDVMTLKHTTWLTEMRVRLLHAYQTTSSKAQQALELNEQFMKMVSPDYVLKRGYSLTYKQNKIVKYAKELTAGDEIMIKFTDGEKEGIIK*

📊 Sample Types

Isolate 16.5%
Metagenome 83.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.2%
Kalotermitidae 25.9%
Termitidae 16.7%
Unclassified 7.4%
Termopsidae 5.6%
Rhinotermitidae 3.7%
Passalidae 3.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
4 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2923982719 Parabacteroides sp. 52 Isolate Blattidae
13 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
14 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
15 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
28 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
29 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
30 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
31 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
32 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
33 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
34 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
40 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
41 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
51 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_000466 3300042659 Bacteria 4155
2 Ga0466733_000712 3300042659 Bacteria 18066
3 Ga0466709_036310 3300042648 Bacteria 4450
4 Ga0466727_182627 3300042655 Bacteria 3706
5 Ga0466711_073420 3300042615 Bacteria 7522
6 Ga0466723_228039 3300042618 Bacteria 5009
7 Ga0466706_174920 3300042599 Bacteria 12699
8 JGI24702J35022_10003876 3300002462 Bacteria 8973
9 JGI24702J35022_10008441 3300002462 Bacteria 5828
10 Ga0068305_10282459 3300005083 Unclassified 1870
11 Ga0466656_339094 3300042550 Bacteria 13117
12 Ga0466690_223492 3300042590 Bacteria 14225
13 Ga0466703_048088 3300042636 Bacteria 40180
14 Ga0466704_108124 3300042643 Bacteria 8750
15 Ga0466704_131513 3300042643 Bacteria 17215
16 Ga0466713_120182 3300042602 Bacteria 54854
17 Ga0466716_096367 3300042605 Bacteria 17699
18 Ga0466722_114407 3300042609 Bacteria 3271
19 Ga0466691_135250 3300042593 Bacteria 7136
20 Ga0466704_577676 3300042643 Bacteria 22511
21 Ga0466704_605655 3300042643 Bacteria 6545
22 Ga0466727_051328 3300042655 Bacteria 9580
23 Ga0466727_217856 3300042655 Bacteria 11593
24 Ga0466711_104743 3300042615 Bacteria 2026
25 Ga0466711_451160 3300042615 Bacteria 3426
26 Ga0466715_056991 3300042616 Bacteria 24202
27 Ga0466715_087431 3300042616 Bacteria 8159
28 Ga0466715_440141 3300042616 Bacteria 22634
29 Ga0466728_030496 3300042620 Bacteria 10948
30 Ga0123356_10249370 3300010049 Bacteria 1852
31 Ga0123353_10175965 3300010167 Bacteria 3393
32 Ga0466713_070515 3300042602 Bacteria 21153
33 Ga0466716_416693 3300042605 Bacteria 14814
34 Ga0466691_023060 3300042593 Bacteria 9157
35 Ga0466733_194140 3300042659 Bacteria 44568
36 Ga0466703_143736 3300042636 Bacteria 14178
37 Ga0466711_031881 3300042615 Bacteria 12261
38 Ga0466711_381735 3300042615 Bacteria 12649
39 Ga0466728_120728 3300042620 Bacteria 2904
40 Ga0466716_331478 3300042605 Bacteria 9034
41 Ga0466716_392237 3300042605 Bacteria 10815
42 Ga0466720_176997 3300042607 Bacteria 1973
43 Ga0068305_10048759 3300005083 Bacteria 12061
44 Ga0466696_059472 3300042596 Bacteria 8337
45 Ga0466735_008871 3300042624 Bacteria 3523
46 Ga0466708_196047 3300042652 Bacteria 23939
47 Ga0466708_202391 3300042652 Bacteria 24700
48 Ga0466723_128730 3300042618 Bacteria 22067
49 Ga0466728_044780 3300042620 Bacteria 82368
50 Ga0466728_112903 3300042620 Bacteria 9717
51 Ga0466729_123526 3300042621 Bacteria 33019
52 Ga0466713_094149 3300042602 Bacteria 1817
53 Ga0466719_159624 3300042606 Bacteria 6957
54 IMNBL1DRAFT_c0003075 3300000062 Bacteria 11018
55 Ga0466696_058256 3300042596 Bacteria 6544
56 Ga0466705_007402 3300042612 Bacteria 4863
57 Ga0466733_209304 3300042659 Bacteria 1691
58 Ga0466703_295854 3300042636 Bacteria 17375
59 Ga0466704_214585 3300042643 Bacteria 2709
60 Ga0466704_232589 3300042643 Bacteria 9781
61 Ga0466704_483426 3300042643 Bacteria 8574
62 Ga0466727_032457 3300042655 Bacteria 13166
63 Ga0466712_023627 3300042614 Bacteria 2591
64 Ga0466728_189190 3300042620 Bacteria 66661
65 Ga0123353_10463752 3300010167 Bacteria 1860
66 Ga0466707_377418 3300042601 Bacteria 7096
67 Ga0466719_156620 3300042606 Bacteria 5700
68 Ga0466722_062983 3300042609 Unclassified 7607
69 IMNBL1DRAFT_c0007521 3300000062 Bacteria 5710
70 JGI24702J35022_10011770 3300002462 Bacteria 4875
71 Ga0068305_10000296 3300005083 Unclassified 17259
72 Ga0466690_062941 3300042590 Bacteria 2231
73 Ga0466733_180514 3300042659 Bacteria 51608
74 Ga0466704_338129 3300042643 Bacteria 3160
75 Ga0466708_235488 3300042652 Bacteria 24641
76 Ga0466711_133415 3300042615 Bacteria 7335
77 Ga0466728_479085 3300042620 Bacteria 2148
78 Ga0123356_10165976 3300010049 Bacteria 2212
79 Ga0466707_408573 3300042601 Bacteria 4228
80 Ga0466713_148662 3300042602 Bacteria 25209
81 Ga0466716_311338 3300042605 Bacteria 24204
82 JGI24705J35276_12233842 3300002504 Bacteria 5106
83 JGI24699J35502_11133945 3300002509 Bacteria 20602
84 Ga0466690_402356 3300042590 Bacteria 64397
85 Ga0466705_102389 3300042612 Bacteria 3544
86 Ga0466705_347674 3300042612 Bacteria 29568
87 Ga0466703_208583 3300042636 Bacteria 4891
88 Ga0466704_357167 3300042643 Bacteria 10119
89 Ga0466704_477462 3300042643 Bacteria 10469
90 Ga0466715_079603 3300042616 Bacteria 222305
91 Ga0466726_136002 3300042619 Bacteria 6598
92 Ga0466728_404970 3300042620 Bacteria 46041
93 Ga0466713_003458 3300042602 Bacteria 44331
94 Ga0466713_039571 3300042602 Bacteria 6046
95 Ga0466713_083739 3300042602 Bacteria 12418
96 Ga0466713_131755 3300042602 Bacteria 1433
97 Ga0466719_121598 3300042606 Bacteria 4993
98 2227494083 2225789004 Bacteria 20109
99 Ga0466691_172619 3300042593 Bacteria 7130
100 Ga0466696_001911 3300042596 Bacteria 82336
101 Ga0466696_011367 3300042596 Bacteria 10462

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02601 Exonuc_VII_L Exonuclease VII, large subunit 152 462 0.94
PF13742 tRNA_anti_2 OB-fold nucleic acid binding domain 20 127 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02601 GO:0008855 exodeoxyribonuclease VII activity MF
PF13742 GO:0003676 nucleic acid binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.