Protein Family IF00777
Metagenome
Isolate
139
Members
50
Samples
134
Scaffolds
186.44
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10009111|JGI24702J35022_100091113
- Length
- 206 aa
- Sequence
- LRRFFQFELYSCKVIKLVAMFDFVDSYPWLLPVIIYFGRICDVTLGTMRIIFVSKGEKSKAPIVGFFEVLIWVVVISQIFSHATNIVAYLAYAAGYATGNFIGLLVENKIGFGYQLFRIYSKKDGVELTKLLNQHGFGSTLIRGEGAIAEVSIIETVVRRRACKSVVEILSDFDPDTFYLIEDVRSKQKGIFAYSSAAGAPRLGK*
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
28.6%
Unclassified
10.2%
Blattidae
6.1%
Termopsidae
6.1%
Passalidae
4.1%
Rhinotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 4 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_007017 | 3300042659 | Bacteria | 9587 |
| 2 | Ga0466701_072379 | 3300042598 | Bacteria | 1070 |
| 3 | Ga0466707_329503 | 3300042601 | Bacteria | 5122 |
| 4 | Ga0466716_223334 | 3300042605 | Bacteria | 4469 |
| 5 | 2227466327 | 2225789004 | Unclassified | 5129 |
| 6 | 2227507127 | 2225789004 | Bacteria | 3646 |
| 7 | IMNBL1DRAFT_c0002307 | 3300000062 | Bacteria | 13392 |
| 8 | IMNBL1DRAFT_c0003002 | 3300000062 | Bacteria | 11180 |
| 9 | Ga0466690_057895 | 3300042590 | Bacteria | 3144 |
| 10 | Ga0466691_221190 | 3300042593 | Bacteria | 20946 |
| 11 | Ga0466703_252316 | 3300042636 | Bacteria | 9130 |
| 12 | Ga0466704_018434 | 3300042643 | Bacteria | 4952 |
| 13 | Ga0466723_261566 | 3300042618 | Bacteria | 1254 |
| 14 | Ga0466707_321078 | 3300042601 | Bacteria | 3346 |
| 15 | Ga0466719_361408 | 3300042606 | Bacteria | 1567 |
| 16 | Ga0466719_562631 | 3300042606 | Bacteria | 16686 |
| 17 | Ga0466722_259634 | 3300042609 | Bacteria | 4757 |
| 18 | Ga0466698_448009 | 3300042610 | Bacteria | 1637 |
| 19 | 2227203024 | 2225789004 | Bacteria | 7741 |
| 20 | 2227277212 | 2225789004 | Bacteria | 1266 |
| 21 | 2227569072 | 2225789004 | Bacteria | 14081 |
| 22 | IMNBL1DRAFT_c0003650 | 3300000062 | Bacteria | 9709 |
| 23 | JGI24702J35022_10004648 | 3300002462 | Bacteria | 8127 |
| 24 | JGI24702J35022_10284640 | 3300002462 | Bacteria | 971 |
| 25 | JGI24705J35276_12195724 | 3300002504 | Bacteria | 1529 |
| 26 | Ga0466696_270387 | 3300042596 | Bacteria | 17241 |
| 27 | Ga0466709_330364 | 3300042648 | Bacteria | 1525 |
| 28 | Ga0466723_218758 | 3300042618 | Bacteria | 10546 |
| 29 | Ga0466733_132962 | 3300042659 | Bacteria | 36267 |
| 30 | Ga0466700_364074 | 3300042600 | Bacteria | 2226 |
| 31 | Ga0466707_400473 | 3300042601 | Bacteria | 9253 |
| 32 | Ga0466716_530989 | 3300042605 | Bacteria | 3105 |
| 33 | Ga0466698_226554 | 3300042610 | Bacteria | 2083 |
| 34 | IMNBL1DRAFT_c0030961 | 3300000062 | Bacteria | 1953 |
| 35 | JGI24702J35022_10076442 | 3300002462 | Bacteria | 1809 |
| 36 | JGI24705J35276_12232819 | 3300002504 | Bacteria | 4530 |
| 37 | Ga0466693_395579 | 3300042592 | Bacteria | 6295 |
| 38 | Ga0466696_440264 | 3300042596 | Bacteria | 2517 |
| 39 | Ga0466696_484122 | 3300042596 | Bacteria | 3823 |
| 40 | Ga0466703_246601 | 3300042636 | Bacteria | 4801 |
| 41 | Ga0466704_227004 | 3300042643 | Bacteria | 2865 |
| 42 | Ga0466709_246760 | 3300042648 | Bacteria | 12601 |
| 43 | Ga0466708_154691 | 3300042652 | Bacteria | 17111 |
| 44 | Ga0466725_249421 | 3300042654 | Bacteria | 18843 |
| 45 | Ga0466710_241371 | 3300042613 | Bacteria | 5967 |
| 46 | Ga0466712_204758 | 3300042614 | Bacteria | 1440 |
| 47 | Ga0466697_131670 | 3300042611 | Bacteria | 1263 |
| 48 | Ga0466705_160540 | 3300042612 | Bacteria | 7165 |
| 49 | Ga0466713_018109 | 3300042602 | Bacteria | 29610 |
| 50 | Ga0466719_488694 | 3300042606 | Bacteria | 2558 |
| 51 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 52 | Ga0466656_336010 | 3300042550 | Bacteria | 2569 |
| 53 | Ga0466696_419265 | 3300042596 | Bacteria | 1165 |
| 54 | Ga0466699_428065 | 3300042597 | Bacteria | 1364 |
| 55 | Ga0123356_11507053 | 3300010049 | Bacteria | 830 |
| 56 | Ga0466704_148810 | 3300042643 | Bacteria | 4714 |
| 57 | Ga0466725_233300 | 3300042654 | Bacteria | 13777 |
| 58 | Ga0466725_268082 | 3300042654 | Bacteria | 1013 |
| 59 | Ga0466715_083664 | 3300042616 | Bacteria | 3486 |
| 60 | Ga0466715_280804 | 3300042616 | Bacteria | 13652 |
| 61 | Ga0466715_633767 | 3300042616 | Bacteria | 40285 |
| 62 | Ga0466723_074044 | 3300042618 | Bacteria | 6440 |
| 63 | Ga0466705_268839 | 3300042612 | Bacteria | 5511 |
| 64 | Ga0466705_347937 | 3300042612 | Bacteria | 6495 |
| 65 | Ga0466733_115242 | 3300042659 | Bacteria | 220013 |
| 66 | Ga0466716_017857 | 3300042605 | Bacteria | 3449 |
| 67 | Ga0466716_309564 | 3300042605 | Bacteria | 24840 |
| 68 | Ga0466719_041040 | 3300042606 | Bacteria | 6856 |
| 69 | Ga0466719_282200 | 3300042606 | Bacteria | 8657 |
| 70 | Ga0466698_013729 | 3300042610 | Bacteria | 1113 |
| 71 | JGI24702J35022_10220515 | 3300002462 | Bacteria | 1093 |
| 72 | Ga0466691_058071 | 3300042593 | Bacteria | 16864 |
| 73 | Ga0466691_117369 | 3300042593 | Bacteria | 22050 |
| 74 | Ga0466696_152000 | 3300042596 | Bacteria | 9405 |
| 75 | Ga0123353_10093170 | 3300010167 | Bacteria | 4854 |
| 76 | Ga0123353_10368666 | 3300010167 | Bacteria | 2154 |
| 77 | Ga0466735_012808 | 3300042624 | Bacteria | 3211 |
| 78 | Ga0466703_047583 | 3300042636 | Bacteria | 1899 |
| 79 | Ga0466704_260993 | 3300042643 | Bacteria | 2364 |
| 80 | Ga0466727_061500 | 3300042655 | Bacteria | 10269 |
| 81 | Ga0466727_275224 | 3300042655 | Bacteria | 5076 |
| 82 | Ga0466710_058619 | 3300042613 | Bacteria | 5593 |
| 83 | Ga0466718_077751 | 3300042617 | Bacteria | 1201 |
| 84 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 85 | Ga0466726_156533 | 3300042619 | Bacteria | 4413 |
| 86 | Ga0466728_213038 | 3300042620 | Bacteria | 10370 |
| 87 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 88 | Ga0466713_100016 | 3300042602 | Bacteria | 46673 |
| 89 | IMNBL1DRAFT_c0000519 | 3300000062 | Bacteria | 31668 |
| 90 | IMNBL1DRAFT_c0110284 | 3300000062 | Bacteria | 731 |
| 91 | JGI24702J35022_10009111 | 3300002462 | Bacteria | 5590 |
| 92 | JGI24702J35022_10370481 | 3300002462 | Bacteria | 860 |
| 93 | Ga0466690_111029 | 3300042590 | Bacteria | 12468 |
| 94 | Ga0466694_078745 | 3300042594 | Bacteria | 1349 |
| 95 | Ga0466696_461997 | 3300042596 | Bacteria | 7768 |
| 96 | Ga0123356_10245675 | 3300010049 | Unclassified | 1864 |
| 97 | Ga0466703_334538 | 3300042636 | Bacteria | 14199 |
| 98 | Ga0466704_325237 | 3300042643 | Bacteria | 3176 |
| 99 | Ga0466709_336893 | 3300042648 | Bacteria | 4761 |
| 100 | Ga0466711_018045 | 3300042615 | Bacteria | 12600 |
| 101 | Ga0466728_270835 | 3300042620 | Bacteria | 1306 |
| 102 | 2227591285 | 2225789004 | Bacteria | 47849 |
| 103 | JGI24702J35022_10040904 | 3300002462 | Bacteria | 2472 |
| 104 | JGI24702J35022_10124026 | 3300002462 | Bacteria | 1429 |
| 105 | Ga0068305_10229185 | 3300005083 | Unclassified | 1259 |
| 106 | Ga0072940_1115683 | 3300005200 | Bacteria | 1111 |
| 107 | Ga0072940_1151613 | 3300005200 | Bacteria | 935 |
| 108 | Ga0466656_127395 | 3300042550 | Bacteria | 1111 |
| 109 | Ga0466690_101782 | 3300042590 | Bacteria | 2896 |
| 110 | Ga0466693_029626 | 3300042592 | Bacteria | 1601 |
| 111 | Ga0123355_10011693 | 3300009826 | Bacteria | 13551 |
| 112 | Ga0123354_10055837 | 3300010882 | Bacteria | 5903 |
| 113 | Ga0466735_090434 | 3300042624 | Bacteria | 4006 |
| 114 | Ga0466703_358563 | 3300042636 | Bacteria | 5540 |
| 115 | Ga0466709_199995 | 3300042648 | Bacteria | 19280 |
| 116 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 117 | Ga0466727_335439 | 3300042655 | Bacteria | 18470 |
| 118 | Ga0466711_145131 | 3300042615 | Bacteria | 39663 |
| 119 | Ga0466715_108797 | 3300042616 | Bacteria | 5158 |
| 120 | Ga0466715_602253 | 3300042616 | Bacteria | 6704 |
| 121 | Ga0466701_080230 | 3300042598 | Bacteria | 1598 |
| 122 | Ga0466713_023468 | 3300042602 | Bacteria | 115789 |
| 123 | IMNBL1DRAFT_c0129413 | 3300000062 | Bacteria | 658 |
| 124 | JGI24702J35022_10005365 | 3300002462 | Bacteria | 7508 |
| 125 | Ga0072940_1296652 | 3300005200 | Bacteria | 737 |
| 126 | Ga0072941_1239184 | 3300005201 | Bacteria | 1817 |
| 127 | Ga0123356_11073260 | 3300010049 | Bacteria | 974 |
| 128 | Ga0466704_346815 | 3300042643 | Bacteria | 2933 |
| 129 | Ga0466709_272331 | 3300042648 | Bacteria | 6175 |
| 130 | Ga0466724_33048 | 3300042649 | Bacteria | 5229 |
| 131 | Ga0466708_431015 | 3300042652 | Bacteria | 60350 |
| 132 | Ga0466727_020679 | 3300042655 | Bacteria | 20100 |
| 133 | Ga0466727_040609 | 3300042655 | Bacteria | 2948 |
| 134 | Ga0466728_087702 | 3300042620 | Bacteria | 35663 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.