Protein Family IF00775
Metagenome
Isolate
138
Members
48
Samples
131
Scaffolds
190.98
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10008588|JGI24702J35022_100085885
- Length
- 214 aa
- Sequence
- MTLTNPETNSAAGGKPVKFLIISGNPKKDGLCKSITEEIERGARQGGADVEIVTTEKITRCRVCGDGWGTCRSGNICAFGEDGYNELQEKVKNADLLCLITPVYWGETAEGLKAFMDRLRRCEFAMFGGNGILAGKQTLLVASPGGSGNGLLTCLQQMERFCQHTGAVIFDYIGVNRWNRVYKKEAAYNAALSMAKGVKNGDNAEYSPQTAQP*
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.9%
Kalotermitidae
21.3%
Unclassified
19.1%
Termopsidae
6.4%
Hodotermitidae
2.1%
Rhinotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 13 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 19 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 38 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_224574 | 3300042612 | Bacteria | 9558 |
| 2 | Ga0123355_10308830 | 3300009826 | Bacteria | 2146 |
| 3 | Ga0123356_10000539 | 3300010049 | Bacteria | 42156 |
| 4 | Ga0123356_10301232 | 3300010049 | Unclassified | 1708 |
| 5 | Ga0123356_10657596 | 3300010049 | Bacteria | 1215 |
| 6 | Ga0123353_10263610 | 3300010167 | Bacteria | 2659 |
| 7 | Ga0123353_10420105 | 3300010167 | Bacteria | 1982 |
| 8 | Ga0123353_10691082 | 3300010167 | Unclassified | 1434 |
| 9 | AustNasuHG_c1000692 | 3300000089 | Bacteria | 11983 |
| 10 | Ga0466718_039942 | 3300042617 | Bacteria | 8524 |
| 11 | Ga0466718_127487 | 3300042617 | Unclassified | 1771 |
| 12 | Ga0466726_476133 | 3300042619 | Bacteria | 1019 |
| 13 | Ga0415639_084190 | 3300038395 | Unclassified | 1713 |
| 14 | Ga0466731_415770 | 3300042622 | Bacteria | 1394 |
| 15 | Ga0466708_119001 | 3300042652 | Bacteria | 10164 |
| 16 | Ga0466727_221280 | 3300042655 | Bacteria | 1730 |
| 17 | Ga0466727_305969 | 3300042655 | Unclassified | 4753 |
| 18 | Ga0466713_017270 | 3300042602 | Bacteria | 126285 |
| 19 | Ga0466719_146451 | 3300042606 | Bacteria | 1856 |
| 20 | Ga0466720_036788 | 3300042607 | Bacteria | 1652 |
| 21 | Ga0123356_10020235 | 3300010049 | Bacteria | 6298 |
| 22 | Ga0466726_167536 | 3300042619 | Bacteria | 1366 |
| 23 | Ga0466702_158219 | 3300042635 | Bacteria | 1545 |
| 24 | Ga0466700_400562 | 3300042600 | Bacteria | 2120 |
| 25 | Ga0466714_077887 | 3300042603 | Bacteria | 1418 |
| 26 | Ga0466721_021748 | 3300042608 | Bacteria | 47247 |
| 27 | Ga0123356_10960038 | 3300010049 | Bacteria | 1025 |
| 28 | Ga0123353_11013527 | 3300010167 | Bacteria | 1114 |
| 29 | Ga0074263_111919 | 3300005485 | Bacteria | 2866 |
| 30 | Ga0466711_261695 | 3300042615 | Bacteria | 3569 |
| 31 | Ga0466718_058808 | 3300042617 | Bacteria | 10909 |
| 32 | Ga0466728_325677 | 3300042620 | Bacteria | 4553 |
| 33 | Ga0466735_119299 | 3300042624 | Bacteria | 1055 |
| 34 | Ga0466727_131361 | 3300042655 | Bacteria | 1319 |
| 35 | Ga0466706_203496 | 3300042599 | Bacteria | 1070 |
| 36 | Ga0466714_022567 | 3300042603 | Bacteria | 13398 |
| 37 | Ga0466720_068075 | 3300042607 | Bacteria | 1520 |
| 38 | Ga0466705_088193 | 3300042612 | Bacteria | 1717 |
| 39 | Ga0123356_10679324 | 3300010049 | Bacteria | 1198 |
| 40 | Ga0123354_10121819 | 3300010882 | Bacteria | 3363 |
| 41 | AustNasuHG_c1009077 | 3300000089 | Bacteria | 3505 |
| 42 | JGI24705J35276_12180008 | 3300002504 | Bacteria | 1360 |
| 43 | Ga0466711_490104 | 3300042615 | Bacteria | 12804 |
| 44 | Ga0466718_039092 | 3300042617 | Bacteria | 4344 |
| 45 | Ga0466718_124453 | 3300042617 | Unclassified | 4491 |
| 46 | Ga0466718_135451 | 3300042617 | Bacteria | 1500 |
| 47 | Ga0466709_027185 | 3300042648 | Bacteria | 2449 |
| 48 | Ga0466709_043829 | 3300042648 | Bacteria | 4714 |
| 49 | Ga0466727_057670 | 3300042655 | Bacteria | 4456 |
| 50 | Ga0466727_174269 | 3300042655 | Bacteria | 2263 |
| 51 | Ga0466706_034774 | 3300042599 | Bacteria | 1224 |
| 52 | Ga0466706_261044 | 3300042599 | Bacteria | 12564 |
| 53 | Ga0466707_141029 | 3300042601 | Bacteria | 15532 |
| 54 | Ga0466707_185979 | 3300042601 | Bacteria | 29459 |
| 55 | Ga0466719_380721 | 3300042606 | Bacteria | 3550 |
| 56 | Ga0466720_027309 | 3300042607 | Bacteria | 5413 |
| 57 | Ga0466720_139652 | 3300042607 | Bacteria | 1911 |
| 58 | Ga0466720_155464 | 3300042607 | Bacteria | 1050 |
| 59 | Ga0466720_185127 | 3300042607 | Bacteria | 4513 |
| 60 | Ga0466720_222706 | 3300042607 | Unclassified | 1214 |
| 61 | Ga0466732_015148 | 3300042656 | Bacteria | 3437 |
| 62 | Ga0466732_455626 | 3300042656 | Bacteria | 3094 |
| 63 | Ga0123357_10150775 | 3300009784 | Bacteria | 2822 |
| 64 | Ga0123355_10958371 | 3300009826 | Bacteria | 917 |
| 65 | Ga0123355_11574882 | 3300009826 | Bacteria | 635 |
| 66 | Ga0123356_10043436 | 3300010049 | Bacteria | 4185 |
| 67 | Ga0123353_10000073 | 3300010167 | Bacteria | 109904 |
| 68 | Ga0123353_10090765 | 3300010167 | Bacteria | 4920 |
| 69 | Ga0123353_10315672 | 3300010167 | Bacteria | 2375 |
| 70 | Ga0123353_11227046 | 3300010167 | Bacteria | 981 |
| 71 | AustNasuHG_c1000894 | 3300000089 | Bacteria | 10770 |
| 72 | AustNasuHG_c1016434 | 3300000089 | Unclassified | 2476 |
| 73 | Ga0466726_125209 | 3300042619 | Bacteria | 1242 |
| 74 | Ga0466726_324206 | 3300042619 | Bacteria | 1517 |
| 75 | Ga0415639_026429 | 3300038395 | Bacteria | 7716 |
| 76 | Ga0466693_116011 | 3300042592 | Bacteria | 2084 |
| 77 | Ga0466691_000182 | 3300042593 | Bacteria | 7419 |
| 78 | Ga0466703_074669 | 3300042636 | Bacteria | 3897 |
| 79 | Ga0466727_232903 | 3300042655 | Bacteria | 1206 |
| 80 | Ga0466700_313584 | 3300042600 | Bacteria | 1082 |
| 81 | Ga0466707_042427 | 3300042601 | Bacteria | 15094 |
| 82 | Ga0466707_343574 | 3300042601 | Bacteria | 52541 |
| 83 | Ga0466716_163649 | 3300042605 | Bacteria | 22531 |
| 84 | Ga0466720_015091 | 3300042607 | Bacteria | 18515 |
| 85 | Ga0466720_017698 | 3300042607 | Bacteria | 1055 |
| 86 | Ga0466732_215615 | 3300042656 | Bacteria | 2418 |
| 87 | Ga0123356_10111500 | 3300010049 | Bacteria | 2643 |
| 88 | Ga0123353_10423349 | 3300010167 | Bacteria | 1972 |
| 89 | Ga0466715_421099 | 3300042616 | Bacteria | 1221 |
| 90 | Ga0466718_066125 | 3300042617 | Bacteria | 2912 |
| 91 | Ga0466726_025562 | 3300042619 | Unclassified | 1631 |
| 92 | Ga0466728_484735 | 3300042620 | Bacteria | 6941 |
| 93 | Ga0415639_044576 | 3300038395 | Bacteria | 4053 |
| 94 | Ga0466731_073098 | 3300042622 | Bacteria | 1174 |
| 95 | Ga0466709_343231 | 3300042648 | Bacteria | 13703 |
| 96 | Ga0466727_096242 | 3300042655 | Bacteria | 1948 |
| 97 | Ga0466707_411467 | 3300042601 | Bacteria | 1145 |
| 98 | Ga0466713_143249 | 3300042602 | Bacteria | 3606 |
| 99 | Ga0466717_060373 | 3300042604 | Bacteria | 1084 |
| 100 | Ga0466720_054868 | 3300042607 | Bacteria | 1013 |
| 101 | Ga0466720_078333 | 3300042607 | Bacteria | 3166 |
| 102 | Ga0466720_185543 | 3300042607 | Unclassified | 4242 |
| 103 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 104 | Ga0466733_170770 | 3300042659 | Bacteria | 2282 |
| 105 | Ga0123355_10133432 | 3300009826 | Bacteria | 3820 |
| 106 | Ga0123356_10852752 | 3300010049 | Bacteria | 1082 |
| 107 | AustNasuHG_c1045327 | 3300000089 | Bacteria | 1007 |
| 108 | Ga0466711_213169 | 3300042615 | Bacteria | 1640 |
| 109 | Ga0466715_460971 | 3300042616 | Bacteria | 10003 |
| 110 | Ga0466718_041445 | 3300042617 | Bacteria | 1181 |
| 111 | Ga0466726_475416 | 3300042619 | Bacteria | 11845 |
| 112 | Ga0466706_080656 | 3300042599 | Bacteria | 1264 |
| 113 | Ga0466707_018840 | 3300042601 | Bacteria | 1378 |
| 114 | Ga0466720_017944 | 3300042607 | Bacteria | 63542 |
| 115 | Ga0466722_029785 | 3300042609 | Bacteria | 10359 |
| 116 | Ga0466722_220477 | 3300042609 | Bacteria | 10781 |
| 117 | Ga0123353_11004988 | 3300010167 | Bacteria | 1120 |
| 118 | Ga0123354_10168291 | 3300010882 | Bacteria | 2564 |
| 119 | Nasutiter_Contig41206 | 2030936001 | Unclassified | 791 |
| 120 | AustNasuHG_c1016271 | 3300000089 | Bacteria | 2491 |
| 121 | JGI24702J35022_10008588 | 3300002462 | Bacteria | 5779 |
| 122 | Ga0072941_1277777 | 3300005201 | Bacteria | 2407 |
| 123 | Ga0466718_084360 | 3300042617 | Bacteria | 1050 |
| 124 | Ga0466726_103145 | 3300042619 | Bacteria | 1803 |
| 125 | Ga0466725_016399 | 3300042654 | Bacteria | 1006 |
| 126 | Ga0466727_049336 | 3300042655 | Bacteria | 6416 |
| 127 | Ga0466714_085711 | 3300042603 | Bacteria | 1238 |
| 128 | Ga0466720_067596 | 3300042607 | Unclassified | 15383 |
| 129 | Ga0466721_342042 | 3300042608 | Bacteria | 16544 |
| 130 | Ga0466722_104233 | 3300042609 | Bacteria | 1143 |
| 131 | Ga0466722_237815 | 3300042609 | Bacteria | 13998 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03358 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.