Protein Family IF00771
Metagenome
Isolate
171
Members
80
Samples
150
Scaffolds
313.09
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10006875|JGI24702J35022_100068752
- Length
- 375 aa
- Sequence
- VSESDALNESIAKPVNLIGNADISPTYTGEPAGSPDGRVGRAPSSFTIALNDSVSSGQASSGSAPILISLVVPCYNEQEAIPLLYDEACAVLKDMKQKNIVGEFVFIDDGSVDKTLEVIDRLSKKDDRVHYLSFSRNFGKEAALLAGMQKSRGQFVVTLDVDGQDPPRMIPDMLKPVYSGEFDCACSRRVTRKGEPAIRSFFARIFYKIMGILSDIEIVDGARDFRLMSRAYVDCILSLPESNRFSKGIFPWIGFRTKWFEYENVKRVAGETKWSFVKLFRYSIDGILAFSAKPLAIASVLGVLFFIGSIALIXVVAVRRIMFGDPVAGWASTVCIILFCSGIQLFTTGILGAYLSKAYTEVKQRPRYLVKIEK*
Sample Types
Isolate
12.3%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.9%
Unclassified
17.6%
Kalotermitidae
14.9%
Tenebrionidae
5.4%
Termopsidae
5.4%
Drosophilidae
4.1%
Rhinotermitidae
2.7%
Vespidae
1.4%
Bombycidae
1.4%
Hodotermitidae
1.4%
Hydrophilidae
1.4%
Passalidae
1.4%
Apidae
1.4%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 2 | 2820041270 | Unclassified Saccharibacteria Co191P4bin22 | Isolate | Unclassified |
| 3 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 4 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 5 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 6 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 7 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 8 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 21 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 36 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 37 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 43 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 44 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 45 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 46 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 51 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 61 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 62 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 63 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 70 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 76 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 77 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 78 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 79 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 80 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_054861 | 3300042612 | Bacteria | 3370 |
| 2 | Ga0466705_365605 | 3300042612 | Bacteria | 4055 |
| 3 | Ga0562375_0037 | 3300056856 | Bacteria | 606076 |
| 4 | Ga0466704_542684 | 3300042643 | Bacteria | 2520 |
| 5 | Ga0466727_323246 | 3300042655 | Bacteria | 13797 |
| 6 | AustNasuHG_c1003231 | 3300000089 | Bacteria | 5882 |
| 7 | JGI24702J35022_10006875 | 3300002462 | Bacteria | 6551 |
| 8 | JGI24696J40584_12932256 | 3300002834 | Bacteria | 1499 |
| 9 | Ga0072941_1029383 | 3300005201 | Bacteria | 16244 |
| 10 | Ga0123355_10262449 | 3300009826 | Bacteria | 2413 |
| 11 | Ga0123356_10088656 | 3300010049 | Bacteria | 2942 |
| 12 | Ga0123356_10257666 | 3300010049 | Bacteria | 1826 |
| 13 | Ga0466713_045311 | 3300042602 | Bacteria | 10275 |
| 14 | Ga0466720_223562 | 3300042607 | Bacteria | 2413 |
| 15 | Ga0466715_582288 | 3300042616 | Bacteria | 10954 |
| 16 | Ga0466726_357621 | 3300042619 | Bacteria | 4962 |
| 17 | Ga0264413_100275 | 3300024493 | Bacteria | 6993 |
| 18 | Ga0264413_108624 | 3300024493 | Bacteria | 6420 |
| 19 | Ga0264413_131865 | 3300024493 | Unclassified | 2524 |
| 20 | Ga0264413_136733 | 3300024493 | Bacteria | 3515 |
| 21 | Ga0466699_038142 | 3300042597 | Bacteria | 1166 |
| 22 | Ga0466730_098957 | 3300042625 | Unclassified | 3273 |
| 23 | Ga0466703_006403 | 3300042636 | Bacteria | 4121 |
| 24 | JGI24698J34947_10010778 | 3300002449 | Bacteria | 5017 |
| 25 | JGI24698J34947_10116175 | 3300002449 | Bacteria | 1171 |
| 26 | JGI24696J40584_12961685 | 3300002834 | Bacteria | 35700 |
| 27 | Ga0072941_1084115 | 3300005201 | Bacteria | 2066 |
| 28 | Ga0123355_10001735 | 3300009826 | Bacteria | 30429 |
| 29 | Ga0123353_10196289 | 3300010167 | Bacteria | 3181 |
| 30 | Ga0466706_022973 | 3300042599 | Bacteria | 3039 |
| 31 | Ga0466714_167249 | 3300042603 | Bacteria | 1361 |
| 32 | Ga0466721_171206 | 3300042608 | Bacteria | 36585 |
| 33 | Ga0466710_127925 | 3300042613 | Bacteria | 32899 |
| 34 | Ga0466712_285724 | 3300042614 | Unclassified | 2123 |
| 35 | Ga0466715_018998 | 3300042616 | Unclassified | 3477 |
| 36 | Ga0466729_043722 | 3300042621 | Bacteria | 2757 |
| 37 | Ga0466691_075470 | 3300042593 | Bacteria | 14411 |
| 38 | Ga0466732_241474 | 3300042656 | Bacteria | 6842 |
| 39 | Ga0466735_061695 | 3300042624 | Bacteria | 9727 |
| 40 | Ga0072940_1116067 | 3300005200 | Bacteria | 4774 |
| 41 | Ga0072940_1308134 | 3300005200 | Bacteria | 2017 |
| 42 | Ga0072940_1433740 | 3300005200 | Bacteria | 1185 |
| 43 | Ga0072941_1059850 | 3300005201 | Bacteria | 8040 |
| 44 | Ga0072941_1177452 | 3300005201 | Bacteria | 2531 |
| 45 | Ga0123355_10086996 | 3300009826 | Bacteria | 4968 |
| 46 | Ga0123356_10006646 | 3300010049 | Bacteria | 11655 |
| 47 | Ga0123353_10003606 | 3300010167 | Bacteria | 19610 |
| 48 | Ga0123354_10230706 | 3300010882 | Bacteria | 1936 |
| 49 | Ga0466707_304203 | 3300042601 | Bacteria | 4172 |
| 50 | Ga0466712_083270 | 3300042614 | Bacteria | 2211 |
| 51 | Ga0466712_270394 | 3300042614 | Unclassified | 20542 |
| 52 | Ga0466711_032773 | 3300042615 | Unclassified | 1405 |
| 53 | Ga0466715_387967 | 3300042616 | Bacteria | 50352 |
| 54 | Ga0466715_603008 | 3300042616 | Bacteria | 4646 |
| 55 | Ga0264413_100052 | 3300024493 | Bacteria | 41072 |
| 56 | Ga0466696_289622 | 3300042596 | Bacteria | 7847 |
| 57 | Ga0562374_1063 | 3300057007 | Bacteria | 35863 |
| 58 | Ga0466731_034302 | 3300042622 | Bacteria | 6869 |
| 59 | Ga0466703_254005 | 3300042636 | Bacteria | 2220 |
| 60 | IMNBL1DRAFT_c0001055 | 3300000062 | Bacteria | 21318 |
| 61 | JGI24702J35022_10001358 | 3300002462 | Bacteria | 15188 |
| 62 | JGI24705J35276_12233379 | 3300002504 | Bacteria | 4815 |
| 63 | Ga0123357_10108199 | 3300009784 | Bacteria | 3557 |
| 64 | Ga0123355_10164612 | 3300009826 | Bacteria | 3332 |
| 65 | Ga0123355_10300412 | 3300009826 | Bacteria | 2189 |
| 66 | Ga0123353_10004754 | 3300010167 | Bacteria | 17607 |
| 67 | Ga0466706_204876 | 3300042599 | Bacteria | 3063 |
| 68 | Ga0466700_016731 | 3300042600 | Bacteria | 11547 |
| 69 | Ga0466712_124670 | 3300042614 | Bacteria | 8688 |
| 70 | Ga0466715_306311 | 3300042616 | Bacteria | 12660 |
| 71 | Ga0264413_100276 | 3300024493 | Bacteria | 6809 |
| 72 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 73 | Ga0530661_003783 | 3300056564 | Bacteria | 4813 |
| 74 | Ga0562377_1951 | 3300056842 | Bacteria | 17901 |
| 75 | Ga0466703_208350 | 3300042636 | Bacteria | 2271 |
| 76 | JGI24698J34947_10027126 | 3300002449 | Bacteria | 3040 |
| 77 | JGI24697J35500_11269480 | 3300002507 | Unclassified | 4000 |
| 78 | Ga0068302_10041155 | 3300005071 | Bacteria | 17191 |
| 79 | Ga0072940_1000715 | 3300005200 | Bacteria | 46979 |
| 80 | Ga0123353_10189914 | 3300010167 | Bacteria | 3244 |
| 81 | Ga0123353_10325360 | 3300010167 | Bacteria | 2331 |
| 82 | Ga0466719_358703 | 3300042606 | Bacteria | 3551 |
| 83 | Ga0466712_126935 | 3300042614 | Unclassified | 6599 |
| 84 | Ga0466715_205637 | 3300042616 | Bacteria | 9696 |
| 85 | Ga0466728_077148 | 3300042620 | Unclassified | 4165 |
| 86 | Ga0466728_083471 | 3300042620 | Bacteria | 56340 |
| 87 | Ga0466691_044053 | 3300042593 | Bacteria | 1779 |
| 88 | Ga0466705_203766 | 3300042612 | Bacteria | 2463 |
| 89 | Ga0466705_377825 | 3300042612 | Bacteria | 346954 |
| 90 | Ga0466732_111831 | 3300042656 | Bacteria | 1194 |
| 91 | Ga0562377_0115 | 3300056842 | Bacteria | 253215 |
| 92 | Ga0466734_085678 | 3300042623 | Bacteria | 1451 |
| 93 | Ga0466734_163051 | 3300042623 | Bacteria | 7345 |
| 94 | Ga0466703_377963 | 3300042636 | Bacteria | 7428 |
| 95 | JGI24698J34947_10001496 | 3300002449 | Bacteria | 12356 |
| 96 | JGI24698J34947_10037898 | 3300002449 | Bacteria | 2503 |
| 97 | JGI24697J35500_11222185 | 3300002507 | Bacteria | 1902 |
| 98 | JGI24699J35502_11132259 | 3300002509 | Bacteria | 6603 |
| 99 | Ga0123357_10129472 | 3300009784 | Bacteria | 3149 |
| 100 | Ga0123356_10003226 | 3300010049 | Bacteria | 17138 |
| 101 | Ga0123356_10451244 | 3300010049 | Bacteria | 1434 |
| 102 | Ga0123354_10000973 | 3300010882 | Bacteria | 32464 |
| 103 | Ga0123354_10005735 | 3300010882 | Bacteria | 18172 |
| 104 | Ga0466717_031800 | 3300042604 | Bacteria | 5561 |
| 105 | Ga0466705_476604 | 3300042612 | Bacteria | 14000 |
| 106 | Ga0466712_057263 | 3300042614 | Bacteria | 1966 |
| 107 | Ga0466712_092683 | 3300042614 | Bacteria | 8365 |
| 108 | Ga0264413_107337 | 3300024493 | Bacteria | 7523 |
| 109 | Ga0466690_029951 | 3300042590 | Unclassified | 1155 |
| 110 | Ga0466695_275797 | 3300042595 | Bacteria | 15069 |
| 111 | Ga0466703_153521 | 3300042636 | Bacteria | 25421 |
| 112 | Ga0466724_53191 | 3300042649 | Bacteria | 6132 |
| 113 | JGI24698J34947_10001845 | 3300002449 | Bacteria | 11302 |
| 114 | JGI24698J34947_10028002 | 3300002449 | Bacteria | 2986 |
| 115 | JGI24698J34947_10034742 | 3300002449 | Unclassified | 2635 |
| 116 | JGI24695J34938_10000019 | 3300002450 | Bacteria | 113818 |
| 117 | JGI24695J34938_10000143 | 3300002450 | Bacteria | 65111 |
| 118 | JGI24695J34938_10000494 | 3300002450 | Bacteria | 38207 |
| 119 | Ga0072940_1033915 | 3300005200 | Bacteria | 6032 |
| 120 | Ga0105553_1001864 | 3300007767 | Bacteria | 6789 |
| 121 | Ga0123355_10086584 | 3300009826 | Bacteria | 4982 |
| 122 | Ga0123355_10100758 | 3300009826 | Bacteria | 4548 |
| 123 | Ga0123356_10000497 | 3300010049 | Bacteria | 43842 |
| 124 | Ga0123354_10111851 | 3300010882 | Bacteria | 3600 |
| 125 | Ga0466707_255670 | 3300042601 | Bacteria | 5868 |
| 126 | Ga0466713_083861 | 3300042602 | Bacteria | 153241 |
| 127 | Ga0466717_070224 | 3300042604 | Bacteria | 2062 |
| 128 | Ga0466719_335353 | 3300042606 | Bacteria | 8466 |
| 129 | Ga0466720_030847 | 3300042607 | Bacteria | 16885 |
| 130 | Ga0466720_033071 | 3300042607 | Bacteria | 39305 |
| 131 | Ga0466722_044560 | 3300042609 | Bacteria | 1985 |
| 132 | Ga0466722_217025 | 3300042609 | Bacteria | 3301 |
| 133 | Ga0466722_250924 | 3300042609 | Bacteria | 1367 |
| 134 | Ga0466712_133436 | 3300042614 | Bacteria | 1790 |
| 135 | Ga0466715_257295 | 3300042616 | Bacteria | 129667 |
| 136 | Ga0466718_051974 | 3300042617 | Bacteria | 6971 |
| 137 | Ga0264413_118005 | 3300024493 | Bacteria | 7785 |
| 138 | Ga0466690_008152 | 3300042590 | Bacteria | 8252 |
| 139 | Ga0466695_074130 | 3300042595 | Bacteria | 7546 |
| 140 | Ga0466704_560442 | 3300042643 | Bacteria | 2576 |
| 141 | JGI24698J34947_10015770 | 3300002449 | Bacteria | 4109 |
| 142 | JGI24702J35022_10066558 | 3300002462 | Bacteria | 1934 |
| 143 | Ga0123355_10049117 | 3300009826 | Bacteria | 6861 |
| 144 | Ga0466713_092878 | 3300042602 | Bacteria | 86932 |
| 145 | Ga0466720_179756 | 3300042607 | Bacteria | 3388 |
| 146 | Ga0466712_223389 | 3300042614 | Unclassified | 4469 |
| 147 | Ga0466715_521573 | 3300042616 | Bacteria | 35190 |
| 148 | Ga0466723_071107 | 3300042618 | Unclassified | 4243 |
| 149 | Ga0415639_034451 | 3300038395 | Bacteria | 4927 |
| 150 | Ga0466699_211042 | 3300042597 | Bacteria | 1136 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.