Protein Family IF00735
Metagenome
Isolate
122
Members
49
Samples
116
Scaffolds
487.64
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10000242|JGI24702J35022_1000024217
- Length
- 524 aa
- Sequence
- MKPTKKPRKGDPINLTVDFIYGHTKSTGMKNLAKDTAIYGVSSIIGRFLNWMLVPLYTRILQSTGEYGVVTNIYGWIALLLVILTYGMETGFFRFINKKEEQEPIRVYATTLYSIAFTSFLFIAGVLLFLNPVSTVLGYGDHPEYIGMMACVVAVDAICCIPFAYLRYQCRPVRFAAIKSFNIFLNISLNLFFLVLCPKLNNSHPELIKWFYRPEYGVGYIFISNIFTTAITFLMLMPNMLPALRAKFDRQRLKKMLRYSAPILILGAAGIFNQTAASILFPFLFEDRGLAESQLGIYGGCLKIAVVMIMFIQAFRYAYEPFIFAKNKDSDNKKSYIEAMKYFVIFSLVIFLGVMFYIDVIKHFVESEYYSGLSVVPIVMLGELFFGVYFNLSVWYKLTDKTHWGAYFSIAGCALTVAIIIGFVPHYGFIACAWASFASNLLMMLLSYFIGQKKFPVAYNLRSALFYISIAAAFYAVAMLPTIESTFLRLAYRTVFLIVFFAIIIKKDLPSFPKKNHEPVKPS*
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Kalotermitidae
28.6%
Unclassified
12.2%
Blattidae
6.1%
Rhinotermitidae
6.1%
Passalidae
4.1%
Termopsidae
4.1%
Drosophilidae
2.0%
Tenebrionidae
2.0%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 13 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 2 | Ga0123354_10017301 | 3300010882 | Bacteria | 11293 |
| 3 | Ga0466703_082815 | 3300042636 | Bacteria | 22209 |
| 4 | Ga0466704_027280 | 3300042643 | Bacteria | 6629 |
| 5 | Ga0466727_186998 | 3300042655 | Bacteria | 10433 |
| 6 | Ga0466711_010060 | 3300042615 | Bacteria | 4253 |
| 7 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 8 | Ga0466715_368985 | 3300042616 | Bacteria | 23885 |
| 9 | Ga0466728_021517 | 3300042620 | Bacteria | 26535 |
| 10 | 2227607682 | 2225789004 | Bacteria | 2287 |
| 11 | JGI24699J35502_11134172 | 3300002509 | Bacteria | 43867 |
| 12 | Ga0466707_061575 | 3300042601 | Bacteria | 2280 |
| 13 | Ga0466707_290530 | 3300042601 | Bacteria | 21845 |
| 14 | Ga0466719_084339 | 3300042606 | Bacteria | 4874 |
| 15 | Ga0466722_143082 | 3300042609 | Bacteria | 36937 |
| 16 | Ga0123357_10006658 | 3300009784 | Bacteria | 14153 |
| 17 | Ga0466693_034129 | 3300042592 | Bacteria | 1666 |
| 18 | Ga0466691_005929 | 3300042593 | Bacteria | 29416 |
| 19 | Ga0466735_165320 | 3300042624 | Bacteria | 4046 |
| 20 | Ga0466703_128766 | 3300042636 | Bacteria | 7270 |
| 21 | Ga0466723_284577 | 3300042618 | Bacteria | 30836 |
| 22 | IMNBL1DRAFT_c0002135 | 3300000062 | Bacteria | 14050 |
| 23 | JGI24696J40584_12960618 | 3300002834 | Bacteria | 7801 |
| 24 | Ga0466719_233077 | 3300042606 | Bacteria | 7073 |
| 25 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 26 | Ga0466722_038280 | 3300042609 | Bacteria | 17685 |
| 27 | Ga0466722_092954 | 3300042609 | Bacteria | 48543 |
| 28 | Ga0466733_022265 | 3300042659 | Bacteria | 16837 |
| 29 | Ga0123357_10154536 | 3300009784 | Bacteria | 2772 |
| 30 | Ga0123353_10041380 | 3300010167 | Bacteria | 7278 |
| 31 | Ga0466690_143362 | 3300042590 | Bacteria | 6878 |
| 32 | Ga0466696_160857 | 3300042596 | Bacteria | 18353 |
| 33 | Ga0466735_116378 | 3300042624 | Bacteria | 5806 |
| 34 | Ga0466703_001595 | 3300042636 | Bacteria | 18307 |
| 35 | Ga0466715_253260 | 3300042616 | Bacteria | 69795 |
| 36 | Ga0466718_146032 | 3300042617 | Bacteria | 3461 |
| 37 | Ga0466728_020126 | 3300042620 | Bacteria | 8482 |
| 38 | IMNBL1DRAFT_c0003116 | 3300000062 | Bacteria | 10933 |
| 39 | JGI24702J35022_10000242 | 3300002462 | Bacteria | 31179 |
| 40 | JGI24699J35502_11133427 | 3300002509 | Bacteria | 10493 |
| 41 | Ga0466701_017207 | 3300042598 | Bacteria | 16192 |
| 42 | Ga0466713_112916 | 3300042602 | Bacteria | 35573 |
| 43 | Ga0466716_063852 | 3300042605 | Bacteria | 9573 |
| 44 | Ga0466716_346595 | 3300042605 | Bacteria | 12500 |
| 45 | Ga0466721_240868 | 3300042608 | Unclassified | 1329 |
| 46 | Ga0466691_214859 | 3300042593 | Bacteria | 4353 |
| 47 | Ga0466696_019403 | 3300042596 | Bacteria | 8498 |
| 48 | Ga0466696_192956 | 3300042596 | Bacteria | 11134 |
| 49 | Ga0466703_034576 | 3300042636 | Bacteria | 8775 |
| 50 | Ga0466704_286323 | 3300042643 | Unclassified | 5767 |
| 51 | Ga0466708_297978 | 3300042652 | Bacteria | 6892 |
| 52 | Ga0466708_391593 | 3300042652 | Bacteria | 20677 |
| 53 | Ga0466725_139670 | 3300042654 | Bacteria | 26650 |
| 54 | Ga0466715_270390 | 3300042616 | Bacteria | 25190 |
| 55 | Ga0466715_506261 | 3300042616 | Bacteria | 34502 |
| 56 | Ga0466729_121623 | 3300042621 | Bacteria | 6597 |
| 57 | 2227082781 | 2225789004 | Bacteria | 1871 |
| 58 | JGI24702J35022_10003541 | 3300002462 | Bacteria | 9413 |
| 59 | Ga0466713_086468 | 3300042602 | Bacteria | 93752 |
| 60 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 61 | Ga0466716_128466 | 3300042605 | Bacteria | 7233 |
| 62 | Ga0466733_124172 | 3300042659 | Bacteria | 27546 |
| 63 | Ga0123355_10030302 | 3300009826 | Bacteria | 8767 |
| 64 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 65 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 66 | Ga0466696_182506 | 3300042596 | Bacteria | 11867 |
| 67 | Ga0466696_182725 | 3300042596 | Bacteria | 17837 |
| 68 | Ga0466696_198037 | 3300042596 | Bacteria | 25609 |
| 69 | Ga0466696_458987 | 3300042596 | Bacteria | 4331 |
| 70 | Ga0466715_623799 | 3300042616 | Bacteria | 6372 |
| 71 | Ga0466723_190749 | 3300042618 | Bacteria | 41750 |
| 72 | Ga0466728_108554 | 3300042620 | Bacteria | 25332 |
| 73 | 2227476018 | 2225789004 | Bacteria | 4647 |
| 74 | IMNBL1DRAFT_c0001240 | 3300000062 | Bacteria | 19239 |
| 75 | IMNBL1DRAFT_c0002089 | 3300000062 | Bacteria | 14219 |
| 76 | IMNBL1DRAFT_c0021054 | 3300000062 | Bacteria | 2620 |
| 77 | Ga0466701_056175 | 3300042598 | Bacteria | 61782 |
| 78 | Ga0466707_186109 | 3300042601 | Bacteria | 3087 |
| 79 | Ga0466716_466289 | 3300042605 | Bacteria | 6059 |
| 80 | Ga0466719_037606 | 3300042606 | Bacteria | 9015 |
| 81 | Ga0466705_302460 | 3300042612 | Bacteria | 17135 |
| 82 | Ga0123354_10197756 | 3300010882 | Bacteria | 2223 |
| 83 | Ga0466656_171987 | 3300042550 | Bacteria | 10965 |
| 84 | Ga0466690_129506 | 3300042590 | Bacteria | 9562 |
| 85 | Ga0466696_087427 | 3300042596 | Bacteria | 2421 |
| 86 | Ga0466709_359738 | 3300042648 | Bacteria | 20010 |
| 87 | Ga0466728_154588 | 3300042620 | Bacteria | 35846 |
| 88 | IMNBL1DRAFT_c0024131 | 3300000062 | Bacteria | 2364 |
| 89 | Ga0068305_10025013 | 3300005083 | Bacteria | 12026 |
| 90 | Ga0466733_104531 | 3300042659 | Unclassified | 3777 |
| 91 | Ga0123353_10470813 | 3300010167 | Bacteria | 1842 |
| 92 | Ga0466696_032769 | 3300042596 | Bacteria | 4898 |
| 93 | Ga0466731_347524 | 3300042622 | Bacteria | 1821 |
| 94 | Ga0466703_023808 | 3300042636 | Bacteria | 16050 |
| 95 | Ga0466709_285564 | 3300042648 | Bacteria | 5343 |
| 96 | Ga0466727_068971 | 3300042655 | Bacteria | 6037 |
| 97 | Ga0466711_497611 | 3300042615 | Bacteria | 15463 |
| 98 | Ga0466715_142197 | 3300042616 | Bacteria | 15178 |
| 99 | Ga0466729_114635 | 3300042621 | Bacteria | 10167 |
| 100 | 2227164115 | 2225789004 | Bacteria | 36228 |
| 101 | JGI24705J35276_12214599 | 3300002504 | Bacteria | 1968 |
| 102 | JGI24705J35276_12238487 | 3300002504 | Bacteria | 23730 |
| 103 | Ga0466733_113941 | 3300042659 | Bacteria | 30906 |
| 104 | Ga0123354_10001798 | 3300010882 | Bacteria | 27042 |
| 105 | Ga0466690_019619 | 3300042590 | Bacteria | 7516 |
| 106 | Ga0466690_191607 | 3300042590 | Bacteria | 12018 |
| 107 | Ga0466696_273649 | 3300042596 | Bacteria | 8955 |
| 108 | Ga0466704_459583 | 3300042643 | Bacteria | 12491 |
| 109 | Ga0466708_200833 | 3300042652 | Bacteria | 7558 |
| 110 | 2227516313 | 2225789004 | Bacteria | 17602 |
| 111 | JGI24702J35022_10029030 | 3300002462 | Bacteria | 2969 |
| 112 | Ga0104040_1142433 | 3300007149 | Bacteria | 2804 |
| 113 | Ga0123357_10001341 | 3300009784 | Bacteria | 26019 |
| 114 | Ga0466713_023619 | 3300042602 | Bacteria | 28576 |
| 115 | Ga0466719_515791 | 3300042606 | Bacteria | 3286 |
| 116 | Ga0466722_238293 | 3300042609 | Bacteria | 4811 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14667 | Polysacc_synt_C | Polysaccharide biosynthesis C-terminal domain | 377 | 504 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.