Protein Family IF00726

Metagenome Isolate
133 Members
55 Samples
127 Scaffolds
112.13 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10521591|JGI24695J34938_105215911
Length
129 aa
Sequence
LLVLLLLPKENVHCNMLDMKLLFDQNISFRILRLLPNNFSDCKQVRMVGLQDCEDVEIWKFAKQNGFTIVTFDADFFDISVLNGFPPKVIWLRTGNLTTSEIAERIIVNSSNITSFITNSDQSCFYIF*

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 58.5%
Kalotermitidae 15.1%
Unclassified 13.2%
Rhinotermitidae 3.8%
Passalidae 3.8%
Termopsidae 3.8%
Daphniidae 1.9%

🌳 Taxonomy

Archaea 2
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
23 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
33 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
34 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_095607 3300042611 Bacteria 1425
2 Ga0466726_007807 3300042619 Bacteria 1200
3 Ga0466719_144134 3300042606 Bacteria 2714
4 Ga0466721_172837 3300042608 Bacteria 1061
5 Ga0466698_354698 3300042610 Bacteria 1772
6 Ga0466729_198782 3300042621 Bacteria 7913
7 Ga0466704_109359 3300042643 Bacteria 7144
8 Ga0466656_042229 3300042550 Bacteria 1182
9 Ga0466694_059107 3300042594 Bacteria 1779
10 Ga0466694_228170 3300042594 Bacteria 1668
11 Ga0123357_10053767 3300009784 Bacteria 5432
12 Ga0123356_11702238 3300010049 Bacteria 782
13 JGI24698J34947_10155120 3300002449 Bacteria 945
14 JGI24702J35022_10064200 3300002462 Bacteria 1969
15 JGI24702J35022_10240118 3300002462 Bacteria 1051
16 Ga0466697_271819 3300042611 Bacteria 1811
17 Ga0466705_361999 3300042612 Bacteria 3000
18 Ga0466732_011067 3300042656 Bacteria 5647
19 Ga0466705_440873 3300042612 Bacteria 2316
20 Ga0466712_106670 3300042614 Unclassified 1249
21 Ga0466728_114911 3300042620 Bacteria 1522
22 Ga0466707_408883 3300042601 Bacteria 2777
23 Ga0466722_026027 3300042609 Bacteria 3629
24 Ga0466697_048409 3300042611 Bacteria 1176
25 Ga0466704_074528 3300042643 Unclassified 6234
26 Ga0123356_10258473 3300010049 Bacteria 1824
27 Ga0123356_10900083 3300010049 Bacteria 1056
28 Ga0123356_11020522 3300010049 Bacteria 997
29 Ga0123356_13001375 3300010049 Unclassified 589
30 Ga0123353_10460915 3300010167 Bacteria 1868
31 2227286088 2225789004 Bacteria 1249
32 JGI24695J34938_10115308 3300002450 Bacteria 1094
33 JGI24702J35022_10339617 3300002462 Bacteria 895
34 JGI24699J35502_11132712 3300002509 Bacteria 7453
35 JGI24696J40584_12958675 3300002834 Bacteria 4321
36 Ga0466697_204309 3300042611 Bacteria 1066
37 Ga0466712_120325 3300042614 Bacteria 6800
38 Ga0466697_051161 3300042611 Bacteria 2035
39 Ga0466729_310456 3300042621 Bacteria 1000
40 Ga0466704_147929 3300042643 Bacteria 3568
41 Ga0160441_100024 3300012825 Bacteria 253664
42 Ga0466694_066628 3300042594 Bacteria 8771
43 Ga0466695_359914 3300042595 Bacteria 2686
44 Ga0466699_298904 3300042597 Bacteria 2640
45 Ga0123356_10519618 3300010049 Bacteria 1349
46 Ga0123356_13568507 3300010049 Bacteria 539
47 Ga0123353_10341325 3300010167 Bacteria 2262
48 JGI24695J34938_10049696 3300002450 Bacteria 1842
49 JGI24695J34938_10116940 3300002450 Bacteria 1085
50 JGI24702J35022_10081001 3300002462 Bacteria 1759
51 Ga0466733_044052 3300042659 Bacteria 1317
52 Ga0466712_324283 3300042614 Bacteria 25802
53 Ga0466726_268345 3300042619 Bacteria 1380
54 Ga0466735_088351 3300042624 Bacteria 3035
55 Ga0466735_227405 3300042624 Bacteria 2231
56 Ga0466725_243148 3300042654 Bacteria 1324
57 Ga0123356_10858865 3300010049 Bacteria 1079
58 Ga0123353_10403528 3300010167 Bacteria 2033
59 JGI24695J34938_10439779 3300002450 Bacteria 588
60 JGI24702J35022_10315268 3300002462 Bacteria 926
61 JGI24696J40584_12941018 3300002834 Bacteria 1694
62 Ga0123357_10000533 3300009784 Bacteria 37401
63 Ga0466705_075371 3300042612 Bacteria 3896
64 Ga0466710_144300 3300042613 Bacteria 1902
65 Ga0466711_162569 3300042615 Bacteria 1443
66 Ga0466718_144206 3300042617 Bacteria 1292
67 Ga0466722_220880 3300042609 Unclassified 1575
68 Ga0466697_035081 3300042611 Bacteria 1167
69 Ga0466703_003107 3300042636 Bacteria 5246
70 Ga0466703_018071 3300042636 Bacteria 2042
71 Ga0466704_417963 3300042643 Bacteria 12327
72 Ga0466656_230611 3300042550 Bacteria 1707
73 Ga0466657_263730 3300042582 Bacteria 1826
74 Ga0466694_089683 3300042594 Bacteria 1272
75 Ga0466701_003972 3300042598 Bacteria 5957
76 Ga0123356_10688762 3300010049 Archaea 1191
77 JGI24698J34947_10315173 3300002449 Bacteria 559
78 JGI24702J35022_10044388 3300002462 Bacteria 2369
79 JGI24702J35022_10452638 3300002462 Bacteria 782
80 Ga0466710_261863 3300042613 Bacteria 2415
81 Ga0466715_082293 3300042616 Bacteria 6761
82 Ga0466713_061745 3300042602 Bacteria 1630
83 Ga0466704_120513 3300042643 Bacteria 3525
84 Ga0466693_211683 3300042592 Bacteria 1871
85 Ga0466701_009933 3300042598 Bacteria 1430
86 Ga0123356_10342335 3300010049 Bacteria 1616
87 Ga0123353_11330369 3300010167 Bacteria 930
88 JGI24695J34938_10164908 3300002450 Unclassified 912
89 JGI24705J35276_12151064 3300002504 Bacteria 1184
90 JGI24696J40584_12875194 3300002834 Bacteria 1061
91 Ga0072941_1312820 3300005201 Bacteria 864
92 Ga0466705_254203 3300042612 Bacteria 6326
93 Ga0466712_020643 3300042614 Bacteria 2392
94 Ga0466726_126489 3300042619 Bacteria 1954
95 Ga0466722_035516 3300042609 Bacteria 1225
96 Ga0466734_132139 3300042623 Bacteria 1642
97 Ga0466703_055502 3300042636 Bacteria 3148
98 Ga0466725_312765 3300042654 Bacteria 34715
99 Ga0466656_000124 3300042550 Bacteria 2759
100 Ga0466656_272674 3300042550 Bacteria 2493
101 Ga0123355_10000306 3300009826 Bacteria 62944
102 Ga0123356_10539427 3300010049 Bacteria 1327
103 Ga0123354_10491023 3300010882 Bacteria 964
104 Ga0123354_10675211 3300010882 Bacteria 730
105 IMNBL1DRAFT_c0155992 3300000062 Bacteria 584
106 JGI24698J34947_10023652 3300002449 Bacteria 3286
107 JGI24698J34947_10095448 3300002449 Bacteria 1352
108 JGI24702J35022_10000732 3300002462 Bacteria 20150
109 JGI24705J35276_12136322 3300002504 Bacteria 1123
110 Ga0466705_165314 3300042612 Archaea 2108
111 Ga0466710_271302 3300042613 Bacteria 8586
112 Ga0466711_042334 3300042615 Bacteria 8716
113 Ga0466701_033179 3300042598 Bacteria 2118
114 Ga0466700_378421 3300042600 Bacteria 5838
115 Ga0466713_081092 3300042602 Bacteria 3696
116 Ga0466702_287227 3300042635 Unclassified 3038
117 Ga0466704_269871 3300042643 Bacteria 1530
118 Ga0466724_52328 3300042649 Bacteria 1100
119 Ga0466691_033550 3300042593 Bacteria 4161
120 Ga0466691_151315 3300042593 Bacteria 11515
121 Ga0123355_10252839 3300009826 Unclassified 2478
122 Ga0123356_11637025 3300010049 Bacteria 797
123 Ga0123353_10155657 3300010167 Bacteria 3644
124 JGI24698J34947_10242812 3300002449 Unclassified 677
125 JGI24695J34938_10338821 3300002450 Bacteria 658
126 JGI24695J34938_10521591 3300002450 Bacteria 545
127 JGI24702J35022_10097361 3300002462 Bacteria 1607

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_13001375 Ga0123356_130013751 104
2 3300042550 Ga0466656_000124 Ga0466656_000124_1928_2260 110
3 3300042550 Ga0466656_042229 Ga0466656_042229_696_1028 110
4 3300042550 Ga0466656_272674 Ga0466656_272674_1922_2254 110
5 3300042582 Ga0466657_263730 Ga0466657_263730_546_878 110
6 3300042593 Ga0466691_151315 Ga0466691_151315_10754_11086 110
7 3300042594 Ga0466694_059107 Ga0466694_059107_1146_1478 110
8 3300042594 Ga0466694_066628 Ga0466694_066628_8069_8401 110
9 3300042594 Ga0466694_228170 Ga0466694_228170_382_714 110
10 3300042598 Ga0466701_003972 Ga0466701_003972_2604_2936 110
11 3300042598 Ga0466701_009933 Ga0466701_009933_705_1037 110
12 3300042598 Ga0466701_033179 Ga0466701_033179_1412_1744 110
13 3300042600 Ga0466700_378421 Ga0466700_378421_5081_5413 110
14 3300042601 Ga0466707_408883 Ga0466707_408883_1248_1580 110
15 3300042606 Ga0466719_144134 Ga0466719_144134_1834_2166 110
16 3300042608 Ga0466721_172837 Ga0466721_172837_481_813 110
17 3300042609 Ga0466722_026027 Ga0466722_026027_1105_1437 110
18 3300042610 Ga0466698_354698 Ga0466698_354698_1031_1363 110
19 3300042611 Ga0466697_035081 Ga0466697_035081_274_606 110
20 3300042611 Ga0466697_048409 Ga0466697_048409_369_701 110
21 3300042611 Ga0466697_051161 Ga0466697_051161_552_884 110
22 3300042611 Ga0466697_095607 Ga0466697_095607_1019_1351 110
23 3300042612 Ga0466705_165314 Ga0466705_165314_275_607 110
24 3300042612 Ga0466705_361999 Ga0466705_361999_2470_2802 110
25 3300042612 Ga0466705_440873 Ga0466705_440873_52_384 110
26 3300042613 Ga0466710_144300 Ga0466710_144300_402_734 110
27 3300042613 Ga0466710_261863 Ga0466710_261863_289_621 110
28 3300042615 Ga0466711_042334 Ga0466711_042334_578_910 110
29 3300042615 Ga0466711_162569 Ga0466711_162569_726_1058 110
30 3300042617 Ga0466718_144206 Ga0466718_144206_753_1085 110
31 3300042619 Ga0466726_007807 Ga0466726_007807_588_920 110
32 3300042619 Ga0466726_126489 Ga0466726_126489_317_649 110
33 3300042620 Ga0466728_114911 Ga0466728_114911_473_805 110
34 3300042621 Ga0466729_310456 Ga0466729_310456_380_712 110
35 3300042623 Ga0466734_132139 Ga0466734_132139_413_745 110
36 3300042624 Ga0466735_088351 Ga0466735_088351_1569_1901 110
37 3300042624 Ga0466735_227405 Ga0466735_227405_1815_2147 110
38 3300042636 Ga0466703_003107 Ga0466703_003107_4554_4886 110
39 3300042636 Ga0466703_055502 Ga0466703_055502_1472_1804 110
40 3300042643 Ga0466704_074528 Ga0466704_074528_1539_1871 110
41 3300042643 Ga0466704_109359 Ga0466704_109359_4192_4524 110
42 3300042643 Ga0466704_120513 Ga0466704_120513_2982_3314 110
43 3300042643 Ga0466704_147929 Ga0466704_147929_2302_2634 110
44 3300042643 Ga0466704_269871 Ga0466704_269871_215_547 110
45 3300042643 Ga0466704_417963 Ga0466704_417963_521_853 110
46 3300042649 Ga0466724_52328 Ga0466724_52328_452_784 110
47 3300042654 Ga0466725_243148 Ga0466725_243148_492_824 110
48 3300042656 Ga0466732_011067 Ga0466732_011067_3475_3807 110
49 3300042659 Ga0466733_044052 Ga0466733_044052_457_789 110
50 iso_pr_bacteria 2820744581 2820745166 110
51 iso_pr_bacteria 2820759988 2820760309 110
52 iso_pr_bacteria 2820785563 2820786314 110
53 iso_pr_bacteria 2820789850 2820790756 110
54 3300000062 IMNBL1DRAFT_c0155992 IMNBL1DRAFT_01559922 111
55 3300002449 JGI24698J34947_10023652 JGI24698J34947_100236522 111
56 3300002450 JGI24695J34938_10049696 JGI24695J34938_100496962 111
57 3300002450 JGI24695J34938_10115308 JGI24695J34938_101153082 111
58 3300002450 JGI24695J34938_10116940 JGI24695J34938_101169402 111
59 3300002450 JGI24695J34938_10338821 JGI24695J34938_103388212 111
60 3300002450 JGI24695J34938_10439779 JGI24695J34938_104397791 111
61 3300002462 JGI24702J35022_10064200 JGI24702J35022_100642002 111
62 3300002462 JGI24702J35022_10081001 JGI24702J35022_100810013 111
63 3300002462 JGI24702J35022_10240118 JGI24702J35022_102401183 111
64 3300002462 JGI24702J35022_10339617 JGI24702J35022_103396172 111
65 3300002462 JGI24702J35022_10452638 JGI24702J35022_104526381 111
66 3300002504 JGI24705J35276_12136322 JGI24705J35276_121363221 111
67 3300002834 JGI24696J40584_12875194 JGI24696J40584_128751943 111
68 3300002834 JGI24696J40584_12941018 JGI24696J40584_129410182 111
69 3300005201 Ga0072941_1312820 Ga0072941_13128202 111
70 3300009784 Ga0123357_10053767 Ga0123357_100537672 111
71 3300009826 Ga0123355_10000306 Ga0123355_1000030659 111
72 3300009826 Ga0123355_10252839 Ga0123355_102528392 111
73 3300010049 Ga0123356_10342335 Ga0123356_103423353 111
74 3300010049 Ga0123356_10539427 Ga0123356_105394271 111
75 3300010049 Ga0123356_10688762 Ga0123356_106887623 111
76 3300010049 Ga0123356_11020522 Ga0123356_110205222 111
77 3300010049 Ga0123356_11637025 Ga0123356_116370252 111
78 3300010049 Ga0123356_13568507 Ga0123356_135685071 111
79 3300010167 Ga0123353_10341325 Ga0123353_103413253 111
80 3300010167 Ga0123353_10403528 Ga0123353_104035282 111
81 3300010882 Ga0123354_10675211 Ga0123354_106752111 111
82 3300012825 Ga0160441_100024 Ga0160441_100024101 111
83 3300042602 Ga0466713_081092 Ga0466713_081092_1030_1365 111
84 3300042621 Ga0466729_198782 Ga0466729_198782_7333_7668 111
85 3300042635 Ga0466702_287227 Ga0466702_287227_1801_2136 111
86 3300002450 JGI24695J34938_10164908 JGI24695J34938_101649082 112
87 3300010049 Ga0123356_10258473 Ga0123356_102584733 112
88 3300010049 Ga0123356_10519618 Ga0123356_105196182 112
89 3300010049 Ga0123356_10858865 Ga0123356_108588653 112
90 3300042592 Ga0466693_211683 Ga0466693_211683_1181_1519 112
91 3300042593 Ga0466691_033550 Ga0466691_033550_123_461 112
92 3300042602 Ga0466713_061745 Ga0466713_061745_1033_1371 112
93 3300042614 Ga0466712_120325 Ga0466712_120325_201_539 112
94 2225789004 2227286088 2227737403 113
95 3300002449 JGI24698J34947_10155120 JGI24698J34947_101551201 113
96 3300002834 JGI24696J40584_12958675 JGI24696J40584_129586756 113
97 3300010049 Ga0123356_10900083 Ga0123356_109000832 113
98 3300010049 Ga0123356_11702238 Ga0123356_117022382 113
99 3300042594 Ga0466694_089683 Ga0466694_089683_171_512 113
100 3300042595 Ga0466695_359914 Ga0466695_359914_536_877 113
101 3300042597 Ga0466699_298904 Ga0466699_298904_764_1105 113
102 3300042612 Ga0466705_254203 Ga0466705_254203_5824_6165 113
103 3300042613 Ga0466710_271302 Ga0466710_271302_2210_2551 113
104 3300042614 Ga0466712_020643 Ga0466712_020643_251_592 113
105 3300042616 Ga0466715_082293 Ga0466715_082293_2003_2344 113
106 iso_pr_bacteria 2590828803 2592927025 113
107 iso_pr_bacteria 2820776227 2820776611 113
108 3300002449 JGI24698J34947_10242812 JGI24698J34947_102428121 114
109 3300002462 JGI24702J35022_10000732 JGI24702J35022_100007327 114
110 3300002462 JGI24702J35022_10044388 JGI24702J35022_100443882 114
111 3300002462 JGI24702J35022_10097361 JGI24702J35022_100973612 114
112 3300002462 JGI24702J35022_10315268 JGI24702J35022_103152682 114
113 3300002509 JGI24699J35502_11132712 JGI24699J35502_111327123 114
114 3300009784 Ga0123357_10000533 Ga0123357_100005335 114
115 3300010167 Ga0123353_10155657 Ga0123353_101556572 114
116 3300010167 Ga0123353_10460915 Ga0123353_104609152 114
117 3300010882 Ga0123354_10491023 Ga0123354_104910233 114
118 3300042550 Ga0466656_230611 Ga0466656_230611_472_816 114
119 3300042611 Ga0466697_204309 Ga0466697_204309_530_874 114
120 3300042614 Ga0466712_106670 Ga0466712_106670_792_1136 114
121 3300042614 Ga0466712_324283 Ga0466712_324283_22138_22482 114
122 3300042636 Ga0466703_018071 Ga0466703_018071_40_384 114
123 3300002449 JGI24698J34947_10095448 JGI24698J34947_100954483 115
124 3300002449 JGI24698J34947_10315173 JGI24698J34947_103151731 115
125 3300042609 Ga0466722_035516 Ga0466722_035516_861_1211 116
126 3300042609 Ga0466722_220880 Ga0466722_220880_1035_1385 116
127 3300042612 Ga0466705_075371 Ga0466705_075371_2213_2566 117
128 3300042619 Ga0466726_268345 Ga0466726_268345_509_862 117
129 3300042611 Ga0466697_271819 Ga0466697_271819_471_836 121
130 3300002504 JGI24705J35276_12151064 JGI24705J35276_121510642 124
131 3300002450 JGI24695J34938_10521591 JGI24695J34938_105215911 129
132 3300010167 Ga0123353_11330369 Ga0123353_113303691 132
133 3300042654 Ga0466725_312765 Ga0466725_312765_26433_26876 147

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18480 DUF5615 Domain of unknown function (DUF5615) 19 121 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.