Protein Family IF00719

Metagenome Isolate
153 Members
52 Samples
147 Scaffolds
139.55 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10125608|JGI24695J34938_101256082
Length
140 aa
Sequence
MFLNNSYGRTIDIVHRAMDVSMLRRDVIANNLANADTPNFKRSTVNFESQLNRAFQSQKKPALEARMTNEKHISFYQPIDYRTVGPRRVLDYLTQTDPNGNNVDIEQESVHMLKNQLNYQLLSQVLSNQFTQISMVVAR*

πŸ“Š Sample Types

Isolate 3.9%
Metagenome 96.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 56.0%
Kalotermitidae 22.0%
Unclassified 12.0%
Termopsidae 4.0%
Rhinotermitidae 4.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 1
Unclassified 10

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
30 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
49 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_300152 3300042656 Unclassified 1896
2 Ga0123353_10083514 3300010167 Bacteria 5140
3 Ga0123353_10180061 3300010167 Bacteria 3347
4 Ga0123353_10413416 3300010167 Bacteria 2002
5 Ga0123353_10838588 3300010167 Bacteria 1262
6 Ga0123353_10980375 3300010167 Bacteria 1139
7 Ga0466720_018275 3300042607 Bacteria 1021
8 Ga0466718_070332 3300042617 Bacteria 1882
9 Ga0466718_085724 3300042617 Bacteria 1235
10 JGI24698J34947_10138237 3300002449 Bacteria 1030
11 JGI24702J35022_10073557 3300002462 Bacteria 1843
12 Ga0264413_100336 3300024493 Unclassified 2129
13 Ga0415639_001747 3300038395 Bacteria 17768
14 Ga0466694_089628 3300042594 Bacteria 1961
15 Ga0466699_023663 3300042597 Bacteria 1023
16 Ga0466699_160434 3300042597 Bacteria 2775
17 Ga0466731_157630 3300042622 Bacteria 1057
18 Ga0466731_397175 3300042622 Bacteria 13514
19 Ga0123353_10075922 3300010167 Bacteria 5400
20 Ga0123353_10425237 3300010167 Bacteria 1967
21 Ga0123354_10512245 3300010882 Bacteria 928
22 Ga0466719_020025 3300042606 Bacteria 1596
23 Ga0466720_012413 3300042607 Bacteria 1364
24 Ga0466698_027000 3300042610 Bacteria 1727
25 Ga0466712_195897 3300042614 Unclassified 1060
26 Ga0466712_244016 3300042614 Bacteria 1808
27 Ga0466718_136921 3300042617 Bacteria 1211
28 AustNasuHG_c1000911 3300000089 Bacteria 10667
29 JGI24698J34947_10001652 3300002449 Bacteria 11877
30 JGI24698J34947_10022993 3300002449 Bacteria 3337
31 JGI24695J34938_10039377 3300002450 Bacteria 2136
32 JGI24702J35022_10002298 3300002462 Bacteria 11731
33 Ga0415639_127081 3300038395 Bacteria 1173
34 Ga0466691_148346 3300042593 Bacteria 5855
35 Ga0466725_105924 3300042654 Bacteria 1164
36 Ga0123357_10614909 3300009784 Bacteria 825
37 Ga0123356_11039467 3300010049 Bacteria 989
38 Ga0123353_11036649 3300010167 Bacteria 1097
39 Ga0123353_12135952 3300010167 Bacteria 680
40 Ga0123354_10678662 3300010882 Bacteria 727
41 Ga0466706_212342 3300042599 Bacteria 1108
42 Ga0466700_402584 3300042600 Bacteria 1916
43 Ga0466698_218374 3300042610 Bacteria 1034
44 Ga0466712_083459 3300042614 Bacteria 1367
45 Ga0466718_034599 3300042617 Bacteria 11704
46 Ga0466728_237034 3300042620 Bacteria 9493
47 JGI24698J34947_10000618 3300002449 Bacteria 17054
48 JGI24698J34947_10007625 3300002449 Bacteria 5948
49 JGI24698J34947_10148848 3300002449 Bacteria 975
50 JGI24695J34938_10079214 3300002450 Bacteria 1359
51 JGI24702J35022_10000370 3300002462 Bacteria 26677
52 JGI24702J35022_10006980 3300002462 Bacteria 6491
53 Ga0072940_1380429 3300005200 Bacteria 695
54 Ga0466693_364194 3300042592 Bacteria 1764
55 Ga0466731_043769 3300042622 Bacteria 4901
56 Ga0466735_085448 3300042624 Bacteria 3518
57 Ga0466703_292399 3300042636 Bacteria 55753
58 Ga0466704_128155 3300042643 Bacteria 28523
59 Ga0466709_343979 3300042648 Bacteria 10355
60 Ga0466732_210802 3300042656 Bacteria 1161
61 Ga0123357_10007038 3300009784 Bacteria 13848
62 Ga0123355_10066679 3300009826 Bacteria 5793
63 Ga0123356_10377018 3300010049 Bacteria 1550
64 Ga0123356_11624776 3300010049 Bacteria 800
65 Ga0123353_10529723 3300010167 Bacteria 1706
66 Ga0123354_10375857 3300010882 Bacteria 1234
67 Ga0466717_119467 3300042604 Bacteria 1322
68 Ga0466716_095518 3300042605 Bacteria 1938
69 Ga0466722_028565 3300042609 Bacteria 1132
70 Ga0466722_167210 3300042609 Unclassified 6613
71 Ga0466712_026923 3300042614 Unclassified 1057
72 JGI24698J34947_10009619 3300002449 Bacteria 5297
73 JGI24698J34947_10084047 3300002449 Unclassified 1483
74 JGI24695J34938_10226214 3300002450 Bacteria 787
75 JGI24702J35022_10638727 3300002462 Bacteria 660
76 Ga0123357_10001701 3300009784 Bacteria 23703
77 Ga0264413_100335 3300024493 Bacteria 1781
78 Ga0415639_206458 3300038395 Bacteria 1249
79 Ga0466696_271574 3300042596 Bacteria 3928
80 Ga0466729_200857 3300042621 Bacteria 1653
81 Ga0123356_11559787 3300010049 Bacteria 816
82 Ga0123353_10077513 3300010167 Bacteria 5340
83 Ga0123353_10394892 3300010167 Bacteria 2061
84 JGI24695J34938_10125608 3300002450 Bacteria 1045
85 JGI24702J35022_10015386 3300002462 Bacteria 4211
86 Ga0074263_111318 3300005485 Bacteria 1449
87 Ga0415639_042451 3300038395 Bacteria 4588
88 Ga0466694_291972 3300042594 Bacteria 8558
89 Ga0466699_189226 3300042597 Bacteria 1349
90 Ga0466735_001128 3300042624 Bacteria 11786
91 Ga0123357_10110592 3300009784 Bacteria 3504
92 Ga0123356_10787936 3300010049 Bacteria 1121
93 Ga0123356_11373851 3300010049 Bacteria 867
94 Ga0123356_12490123 3300010049 Bacteria 648
95 Ga0123353_10257372 3300010167 Bacteria 2699
96 Ga0123353_11131579 3300010167 Bacteria 1036
97 Ga0123354_10118688 3300010882 Bacteria 3432
98 Ga0466716_093126 3300042605 Bacteria 26989
99 Ga0466719_471340 3300042606 Bacteria 3068
100 Ga0466722_013044 3300042609 Bacteria 28253
101 Ga0466712_008072 3300042614 Unclassified 2047
102 Ga0466712_049651 3300042614 Bacteria 30185
103 Ga0466712_093083 3300042614 Bacteria 12102
104 JGI24698J34947_10081326 3300002449 Unclassified 1519
105 JGI24698J34947_10149102 3300002449 Unclassified 974
106 JGI24705J35276_11708621 3300002504 Bacteria 637
107 JGI24705J35276_12108464 3300002504 Bacteria 1037
108 Ga0072941_1067922 3300005201 Bacteria 1258
109 Ga0466690_212022 3300042590 Bacteria 1860
110 Ga0466699_293492 3300042597 Bacteria 1495
111 Ga0466731_115724 3300042622 Bacteria 44043
112 Ga0466727_022450 3300042655 Bacteria 6398
113 Ga0466732_065748 3300042656 Unclassified 1054
114 Ga0466733_049705 3300042659 Bacteria 2207
115 Ga0123357_10212609 3300009784 Bacteria 2168
116 Ga0123353_10058175 3300010167 Bacteria 6194
117 Ga0123353_11063840 3300010167 Bacteria 1079
118 Ga0123353_11983248 3300010167 Bacteria 714
119 Ga0466722_115318 3300042609 Bacteria 10822
120 Ga0466712_143656 3300042614 Bacteria 26246
121 Ga0466715_497126 3300042616 Bacteria 24776
122 Ga0466729_138173 3300042621 Bacteria 2310
123 JGI24698J34947_10000299 3300002449 Bacteria 21601
124 JGI24702J35022_10046731 3300002462 Bacteria 2304
125 Ga0466694_028793 3300042594 Viruses 1838
126 Ga0466702_111060 3300042635 Bacteria 1182
127 Ga0466708_354560 3300042652 Bacteria 7805
128 Ga0466732_417104 3300042656 Bacteria 1028
129 Ga0123357_10266990 3300009784 Bacteria 1796
130 Ga0123357_10349103 3300009784 Bacteria 1418
131 Ga0123355_10305658 3300009826 Bacteria 2162
132 Ga0123354_10457672 3300010882 Bacteria 1028
133 Ga0466712_180877 3300042614 Bacteria 1043
134 Ga0466718_026738 3300042617 Bacteria 5412
135 JGI24698J34947_10001839 3300002449 Bacteria 11314
136 JGI24698J34947_10027067 3300002449 Bacteria 3043
137 JGI24695J34938_10018224 3300002450 Bacteria 3517
138 JGI24702J35022_10086068 3300002462 Bacteria 1707
139 JGI24705J35276_12044995 3300002504 Bacteria 909
140 Ga0264413_100337 3300024493 Bacteria 1959
141 Ga0415639_101633 3300038395 Bacteria 2426
142 Ga0466690_091323 3300042590 Bacteria 1122
143 Ga0466694_374483 3300042594 Bacteria 2421
144 Ga0466694_406717 3300042594 Bacteria 27989
145 Ga0466695_024946 3300042595 Bacteria 12658
146 Ga0466699_078987 3300042597 Bacteria 3456
147 Ga0466709_230530 3300042648 Bacteria 1934

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_167210 Ga0466722_167210_4158_4529 123
2 3300042617 Ga0466718_034599 Ga0466718_034599_2950_3321 123
3 3300042614 Ga0466712_083459 Ga0466712_083459_700_1074 124
4 3300009826 Ga0123355_10305658 Ga0123355_103056584 125
5 3300005201 Ga0072941_1067922 Ga0072941_10679223 128
6 3300042609 Ga0466722_115318 Ga0466722_115318_7601_7987 128
7 3300038395 Ga0415639_206458 Ga0415639_206458_482_907 134
8 3300038395 Ga0415639_042451 Ga0415639_042451_3105_3518 137
9 3300038395 Ga0415639_101633 Ga0415639_101633_634_1047 137
10 3300042599 Ga0466706_212342 Ga0466706_212342_52_465 137
11 3300042614 Ga0466712_244016 Ga0466712_244016_861_1274 137
12 3300042622 Ga0466731_115724 Ga0466731_115724_24696_25109 137
13 3300042622 Ga0466731_397175 Ga0466731_397175_9641_10054 137
14 3300042624 Ga0466735_001128 Ga0466735_001128_5127_5540 137
15 3300042635 Ga0466702_111060 Ga0466702_111060_424_837 137
16 3300042636 Ga0466703_292399 Ga0466703_292399_7987_8400 137
17 3300042654 Ga0466725_105924 Ga0466725_105924_147_560 137
18 iso_pr_bacteria 2781125640 2781286963 137
19 3300002449 JGI24698J34947_10022993 JGI24698J34947_100229932 138
20 3300002449 JGI24698J34947_10148848 JGI24698J34947_101488481 138
21 3300002449 JGI24698J34947_10149102 JGI24698J34947_101491021 138
22 3300002450 JGI24695J34938_10018224 JGI24695J34938_100182243 138
23 3300009826 Ga0123355_10066679 Ga0123355_100666793 138
24 3300042590 Ga0466690_091323 Ga0466690_091323_172_588 138
25 3300042590 Ga0466690_212022 Ga0466690_212022_786_1202 138
26 3300042593 Ga0466691_148346 Ga0466691_148346_3935_4351 138
27 3300042596 Ga0466696_271574 Ga0466696_271574_3412_3828 138
28 3300042605 Ga0466716_093126 Ga0466716_093126_16536_16952 138
29 3300042605 Ga0466716_095518 Ga0466716_095518_1057_1473 138
30 3300042606 Ga0466719_020025 Ga0466719_020025_82_498 138
31 3300042606 Ga0466719_471340 Ga0466719_471340_1264_1680 138
32 3300042609 Ga0466722_013044 Ga0466722_013044_23626_24042 138
33 3300042616 Ga0466715_497126 Ga0466715_497126_23158_23574 138
34 3300042620 Ga0466728_237034 Ga0466728_237034_6605_7021 138
35 3300042621 Ga0466729_138173 Ga0466729_138173_610_1026 138
36 3300042624 Ga0466735_085448 Ga0466735_085448_1844_2260 138
37 3300042643 Ga0466704_128155 Ga0466704_128155_21095_21511 138
38 3300042648 Ga0466709_230530 Ga0466709_230530_740_1156 138
39 3300042648 Ga0466709_343979 Ga0466709_343979_6353_6769 138
40 3300042652 Ga0466708_354560 Ga0466708_354560_253_669 138
41 3300042655 Ga0466727_022450 Ga0466727_022450_4585_5004 139
42 3300002450 JGI24695J34938_10125608 JGI24695J34938_101256082 140
43 3300002462 JGI24702J35022_10073557 JGI24702J35022_100735573 140
44 3300024493 Ga0264413_100335 Ga0264413_1003353 140
45 3300024493 Ga0264413_100336 Ga0264413_1003362 140
46 3300024493 Ga0264413_100337 Ga0264413_1003371 140
47 3300042594 Ga0466694_028793 Ga0466694_028793_439_861 140
48 3300042594 Ga0466694_089628 Ga0466694_089628_461_883 140
49 3300042594 Ga0466694_291972 Ga0466694_291972_5887_6309 140
50 3300042594 Ga0466694_374483 Ga0466694_374483_1709_2131 140
51 3300042594 Ga0466694_406717 Ga0466694_406717_9903_10325 140
52 3300042595 Ga0466695_024946 Ga0466695_024946_8531_8953 140
53 3300042597 Ga0466699_023663 Ga0466699_023663_517_939 140
54 3300042597 Ga0466699_078987 Ga0466699_078987_2912_3334 140
55 3300042597 Ga0466699_160434 Ga0466699_160434_1663_2085 140
56 3300042597 Ga0466699_189226 Ga0466699_189226_646_1068 140
57 3300042597 Ga0466699_293492 Ga0466699_293492_331_753 140
58 3300042600 Ga0466700_402584 Ga0466700_402584_789_1211 140
59 3300042607 Ga0466720_012413 Ga0466720_012413_333_755 140
60 3300042607 Ga0466720_018275 Ga0466720_018275_161_583 140
61 3300042609 Ga0466722_028565 Ga0466722_028565_611_1033 140
62 3300042610 Ga0466698_027000 Ga0466698_027000_385_807 140
63 3300042610 Ga0466698_218374 Ga0466698_218374_524_946 140
64 3300042614 Ga0466712_008072 Ga0466712_008072_838_1260 140
65 3300042614 Ga0466712_026923 Ga0466712_026923_219_641 140
66 3300042614 Ga0466712_049651 Ga0466712_049651_1861_2283 140
67 3300042614 Ga0466712_093083 Ga0466712_093083_2642_3064 140
68 3300042614 Ga0466712_143656 Ga0466712_143656_3547_3969 140
69 3300042614 Ga0466712_180877 Ga0466712_180877_106_528 140
70 3300042614 Ga0466712_195897 Ga0466712_195897_581_1003 140
71 3300042617 Ga0466718_026738 Ga0466718_026738_541_963 140
72 3300042617 Ga0466718_070332 Ga0466718_070332_897_1319 140
73 3300042617 Ga0466718_085724 Ga0466718_085724_497_919 140
74 3300042617 Ga0466718_136921 Ga0466718_136921_53_475 140
75 3300042622 Ga0466731_043769 Ga0466731_043769_1760_2182 140
76 3300042656 Ga0466732_065748 Ga0466732_065748_29_451 140
77 3300042656 Ga0466732_210802 Ga0466732_210802_363_785 140
78 3300042656 Ga0466732_300152 Ga0466732_300152_1145_1567 140
79 3300042656 Ga0466732_417104 Ga0466732_417104_353_775 140
80 3300042659 Ga0466733_049705 Ga0466733_049705_1428_1850 140
81 iso_pr_bacteria 2781125686 2781419107 140
82 iso_pr_bacteria 2781125690 2781427626 140
83 iso_pr_bacteria 2781125691 2781429511 140
84 iso_pr_bacteria 2781125694 2781436849 140
85 iso_pr_bacteria 2781125697 2781443522 140
86 3300000089 AustNasuHG_c1000911 AustNasuHG_10009114 141
87 3300002449 JGI24698J34947_10000299 JGI24698J34947_1000029921 141
88 3300002449 JGI24698J34947_10000618 JGI24698J34947_100006182 141
89 3300002449 JGI24698J34947_10001652 JGI24698J34947_1000165214 141
90 3300002449 JGI24698J34947_10001839 JGI24698J34947_100018398 141
91 3300002449 JGI24698J34947_10007625 JGI24698J34947_100076252 141
92 3300002449 JGI24698J34947_10009619 JGI24698J34947_100096195 141
93 3300002449 JGI24698J34947_10027067 JGI24698J34947_100270674 141
94 3300002449 JGI24698J34947_10081326 JGI24698J34947_100813262 141
95 3300002449 JGI24698J34947_10084047 JGI24698J34947_100840472 141
96 3300002449 JGI24698J34947_10138237 JGI24698J34947_101382372 141
97 3300002450 JGI24695J34938_10039377 JGI24695J34938_100393772 141
98 3300002450 JGI24695J34938_10079214 JGI24695J34938_100792142 141
99 3300002450 JGI24695J34938_10226214 JGI24695J34938_102262141 141
100 3300002462 JGI24702J35022_10000370 JGI24702J35022_100003706 141
101 3300002462 JGI24702J35022_10002298 JGI24702J35022_100022987 141
102 3300002462 JGI24702J35022_10006980 JGI24702J35022_100069807 141
103 3300002462 JGI24702J35022_10015386 JGI24702J35022_100153864 141
104 3300002462 JGI24702J35022_10046731 JGI24702J35022_100467312 141
105 3300002462 JGI24702J35022_10086068 JGI24702J35022_100860683 141
106 3300002462 JGI24702J35022_10638727 JGI24702J35022_106387271 141
107 3300002504 JGI24705J35276_11708621 JGI24705J35276_117086212 141
108 3300002504 JGI24705J35276_12044995 JGI24705J35276_120449952 141
109 3300002504 JGI24705J35276_12108464 JGI24705J35276_121084642 141
110 3300005200 Ga0072940_1380429 Ga0072940_13804292 141
111 3300005485 Ga0074263_111318 Ga0074263_1113182 141
112 3300009784 Ga0123357_10001701 Ga0123357_100017019 141
113 3300009784 Ga0123357_10007038 Ga0123357_100070382 141
114 3300009784 Ga0123357_10110592 Ga0123357_101105922 141
115 3300009784 Ga0123357_10212609 Ga0123357_102126092 141
116 3300009784 Ga0123357_10266990 Ga0123357_102669902 141
117 3300009784 Ga0123357_10349103 Ga0123357_103491032 141
118 3300009784 Ga0123357_10614909 Ga0123357_106149092 141
119 3300010049 Ga0123356_10377018 Ga0123356_103770183 141
120 3300010049 Ga0123356_10787936 Ga0123356_107879362 141
121 3300010049 Ga0123356_11039467 Ga0123356_110394671 141
122 3300010049 Ga0123356_11373851 Ga0123356_113738512 141
123 3300010049 Ga0123356_11559787 Ga0123356_115597871 141
124 3300010049 Ga0123356_11624776 Ga0123356_116247762 141
125 3300010049 Ga0123356_12490123 Ga0123356_124901232 141
126 3300010167 Ga0123353_10075922 Ga0123353_100759223 141
127 3300010167 Ga0123353_10077513 Ga0123353_100775135 141
128 3300010167 Ga0123353_10083514 Ga0123353_100835142 141
129 3300010167 Ga0123353_10180061 Ga0123353_101800613 141
130 3300010167 Ga0123353_10257372 Ga0123353_102573723 141
131 3300010167 Ga0123353_10394892 Ga0123353_103948923 141
132 3300010167 Ga0123353_10413416 Ga0123353_104134162 141
133 3300010167 Ga0123353_10425237 Ga0123353_104252372 141
134 3300010167 Ga0123353_10529723 Ga0123353_105297232 141
135 3300010167 Ga0123353_10838588 Ga0123353_108385883 141
136 3300010167 Ga0123353_10980375 Ga0123353_109803752 141
137 3300010167 Ga0123353_11036649 Ga0123353_110366492 141
138 3300010167 Ga0123353_11063840 Ga0123353_110638401 141
139 3300010167 Ga0123353_11983248 Ga0123353_119832482 141
140 3300010167 Ga0123353_12135952 Ga0123353_121359522 141
141 3300010882 Ga0123354_10118688 Ga0123354_101186882 141
142 3300010882 Ga0123354_10375857 Ga0123354_103758572 141
143 3300010882 Ga0123354_10457672 Ga0123354_104576722 141
144 3300010882 Ga0123354_10512245 Ga0123354_105122451 141
145 3300010882 Ga0123354_10678662 Ga0123354_106786622 141
146 3300038395 Ga0415639_127081 Ga0415639_127081_366_791 141
147 3300042621 Ga0466729_200857 Ga0466729_200857_428_853 141
148 3300010167 Ga0123353_10058175 Ga0123353_100581756 142
149 3300042604 Ga0466717_119467 Ga0466717_119467_321_761 146
150 3300042622 Ga0466731_157630 Ga0466731_157630_300_740 146
151 3300038395 Ga0415639_001747 Ga0415639_001747_2846_3289 147
152 3300042592 Ga0466693_364194 Ga0466693_364194_1222_1668 148
153 3300010167 Ga0123353_11131579 Ga0123353_111315792 153

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00460 Flg_bb_rod Flagella basal body rod protein 26 41 0.94

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.