Protein Family IF00717
Metagenome
Metatranscriptome
Isolate
150
Members
54
Samples
133
Scaffolds
99.98
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10095664|JGI24695J34938_100956642
- Length
- 104 aa
- Sequence
- MRKMADIKYYDVILKPVVTEKSMDAMADKKYAFYVHPKATKNMVREAVEKLFEGTKVEKVNTMNVMGKKKRTRSYKYGRTPARKKAIIKLTSDSKDIEIFQGM*
Sample Types
Isolate
11.3%
Metagenome
86.7%
MAG
0.0%
Metatranscriptome
2.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.4%
Unclassified
37.7%
Kalotermitidae
5.7%
Passalidae
3.8%
Rhinotermitidae
3.8%
Termopsidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 2 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 3 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 4 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 5 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 14 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 15 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 28 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 29 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 30 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 43 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 44 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 51 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 52 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10811640 | 3300009784 | Bacteria | 630 |
| 2 | Ga0123355_10020764 | 3300009826 | Bacteria | 10499 |
| 3 | Ga0123355_10161208 | 3300009826 | Bacteria | 3379 |
| 4 | Ga0123355_10252195 | 3300009826 | Bacteria | 2482 |
| 5 | Ga0123355_10304217 | 3300009826 | Unclassified | 2169 |
| 6 | Ga0123355_10490639 | 3300009826 | Bacteria | 1522 |
| 7 | Ga0123355_10490783 | 3300009826 | Bacteria | 1521 |
| 8 | Ga0123355_10646149 | 3300009826 | Bacteria | 1236 |
| 9 | Ga0123355_10655606 | 3300009826 | Bacteria | 1223 |
| 10 | Ga0123355_10744663 | 3300009826 | Bacteria | 1110 |
| 11 | Ga0123355_10883502 | 3300009826 | Bacteria | 975 |
| 12 | Ga0123355_10940612 | 3300009826 | Bacteria | 930 |
| 13 | Ga0123355_10968095 | 3300009826 | Bacteria | 910 |
| 14 | Ga0123356_12838564 | 3300010049 | Bacteria | 606 |
| 15 | Ga0123353_11115911 | 3300010167 | Bacteria | 1045 |
| 16 | Ga0466693_110809 | 3300042592 | Bacteria | 1467 |
| 17 | Ga0466695_352172 | 3300042595 | Bacteria | 4668 |
| 18 | IMNBL1DRAFT_c0000272 | 3300000062 | Bacteria | 45809 |
| 19 | IMNBL1DRAFT_c0008644 | 3300000062 | Bacteria | 5158 |
| 20 | JGI24695J34938_10095664 | 3300002450 | Bacteria | 1216 |
| 21 | Ga0466725_082702 | 3300042654 | Bacteria | 32093 |
| 22 | Ga0466725_326548 | 3300042654 | Bacteria | 1248 |
| 23 | Ga0466725_346621 | 3300042654 | Bacteria | 12162 |
| 24 | Ga0466725_392948 | 3300042654 | Bacteria | 12450 |
| 25 | Ga0123355_10004431 | 3300009826 | Bacteria | 20424 |
| 26 | Ga0123355_10298252 | 3300009826 | Bacteria | 2201 |
| 27 | Ga0123355_10386161 | 3300009826 | Bacteria | 1819 |
| 28 | Ga0123355_10543880 | 3300009826 | Bacteria | 1408 |
| 29 | Ga0123355_10722649 | 3300009826 | Bacteria | 1136 |
| 30 | Ga0123355_11055562 | 3300009826 | Bacteria | 853 |
| 31 | Ga0123356_13335702 | 3300010049 | Bacteria | 558 |
| 32 | Ga0123353_10294897 | 3300010167 | Bacteria | 2480 |
| 33 | Ga0123353_10440612 | 3300010167 | Bacteria | 1922 |
| 34 | Ga0233288_1014879 | 3300022232 | Bacteria | 615 |
| 35 | Ga0415639_008065 | 3300038395 | Bacteria | 3438 |
| 36 | Ga0415639_045791 | 3300038395 | Bacteria | 2819 |
| 37 | Ga0415639_164690 | 3300038395 | Bacteria | 2010 |
| 38 | IMNBL1DRAFT_c0149300 | 3300000062 | Bacteria | 601 |
| 39 | JGI24702J35022_10215918 | 3300002462 | Bacteria | 1103 |
| 40 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 41 | Ga0466704_476830 | 3300042643 | Bacteria | 23263 |
| 42 | Ga0466706_225052 | 3300042599 | Bacteria | 1929 |
| 43 | Ga0466714_041056 | 3300042603 | Bacteria | 12167 |
| 44 | Ga0466722_186683 | 3300042609 | Bacteria | 2796 |
| 45 | Ga0466726_252375 | 3300042619 | Bacteria | 2207 |
| 46 | Ga0466733_036718 | 3300042659 | Bacteria | 1124 |
| 47 | Ga0123355_10309347 | 3300009826 | Bacteria | 2144 |
| 48 | Ga0255809_1080778 | 3300022820 | Bacteria | 644 |
| 49 | Ga0415639_088488 | 3300038395 | Bacteria | 2502 |
| 50 | IMNBL1DRAFT_c0036776 | 3300000062 | Bacteria | 1705 |
| 51 | JGI24697J35500_11273971 | 3300002507 | Bacteria | 6293 |
| 52 | JGI24700J35501_10928073 | 3300002508 | Bacteria | 7326 |
| 53 | Ga0466709_346362 | 3300042648 | Bacteria | 31912 |
| 54 | Ga0466707_011714 | 3300042601 | Bacteria | 3315 |
| 55 | Ga0466714_028900 | 3300042603 | Bacteria | 3621 |
| 56 | Ga0466714_111479 | 3300042603 | Bacteria | 8086 |
| 57 | Ga0466722_195997 | 3300042609 | Bacteria | 3498 |
| 58 | Ga0123355_10132502 | 3300009826 | Bacteria | 3836 |
| 59 | Ga0123355_10184901 | 3300009826 | Bacteria | 3084 |
| 60 | Ga0123355_10690685 | 3300009826 | Bacteria | 1176 |
| 61 | Ga0123355_11024337 | 3300009826 | Bacteria | 872 |
| 62 | Ga0123355_11375556 | 3300009826 | Bacteria | 700 |
| 63 | Ga0123356_11515265 | 3300010049 | Bacteria | 828 |
| 64 | Ga0123353_10000953 | 3300010167 | Bacteria | 35371 |
| 65 | Ga0123353_10977634 | 3300010167 | Bacteria | 1141 |
| 66 | Ga0415639_009942 | 3300038395 | Bacteria | 2693 |
| 67 | 2227507959 | 2225789004 | Bacteria | 65570 |
| 68 | IMNBL1DRAFT_c0004808 | 3300000062 | Bacteria | 7967 |
| 69 | IMNBL1DRAFT_c0004990 | 3300000062 | Bacteria | 7745 |
| 70 | JGI24700J35501_10930310 | 3300002508 | Bacteria | 12898 |
| 71 | Ga0068305_10004371 | 3300005083 | Bacteria | 12093 |
| 72 | Ga0072941_1186389 | 3300005201 | Bacteria | 7095 |
| 73 | Ga0466731_394541 | 3300042622 | Bacteria | 1687 |
| 74 | Ga0466702_218309 | 3300042635 | Bacteria | 1540 |
| 75 | Ga0466725_290945 | 3300042654 | Bacteria | 1199 |
| 76 | Ga0466706_217860 | 3300042599 | Bacteria | 3241 |
| 77 | Ga0466706_262416 | 3300042599 | Bacteria | 1185 |
| 78 | Ga0466713_006906 | 3300042602 | Bacteria | 112453 |
| 79 | Ga0466733_104839 | 3300042659 | Bacteria | 6841 |
| 80 | Ga0123355_10730162 | 3300009826 | Bacteria | 1127 |
| 81 | Ga0123355_10917255 | 3300009826 | Unclassified | 948 |
| 82 | Ga0123355_11852631 | 3300009826 | Bacteria | 566 |
| 83 | Ga0123353_10109247 | 3300010167 | Bacteria | 4456 |
| 84 | Ga0123353_12269690 | 3300010167 | Bacteria | 654 |
| 85 | Ga0466698_069584 | 3300042610 | Bacteria | 1112 |
| 86 | Ga0466726_338542 | 3300042619 | Bacteria | 30448 |
| 87 | Ga0123355_10092120 | 3300009826 | Bacteria | 4802 |
| 88 | Ga0123355_10169437 | 3300009826 | Bacteria | 3268 |
| 89 | Ga0123355_10595505 | 3300009826 | Bacteria | 1315 |
| 90 | Ga0123355_10649084 | 3300009826 | Bacteria | 1232 |
| 91 | Ga0123355_10734088 | 3300009826 | Bacteria | 1122 |
| 92 | Ga0123355_11477681 | 3300009826 | Bacteria | 665 |
| 93 | Ga0123355_11704881 | 3300009826 | Bacteria | 600 |
| 94 | Ga0123354_10523561 | 3300010882 | Bacteria | 910 |
| 95 | 2227490016 | 2225789004 | Bacteria | 796 |
| 96 | JGI24703J35330_11746332 | 3300002501 | Bacteria | 5162 |
| 97 | Ga0072940_1523083 | 3300005200 | Bacteria | 691 |
| 98 | Ga0072940_1595235 | 3300005200 | Bacteria | 775 |
| 99 | Ga0466706_202240 | 3300042599 | Bacteria | 9241 |
| 100 | Ga0466733_162242 | 3300042659 | Bacteria | 3158 |
| 101 | Ga0466733_217163 | 3300042659 | Bacteria | 1094 |
| 102 | Ga0123355_10000555 | 3300009826 | Bacteria | 50033 |
| 103 | Ga0123355_10612027 | 3300009826 | Bacteria | 1288 |
| 104 | Ga0123355_10775339 | 3300009826 | Bacteria | 1077 |
| 105 | Ga0123356_11036659 | 3300010049 | Bacteria | 990 |
| 106 | Ga0123353_11052243 | 3300010167 | Bacteria | 1087 |
| 107 | Ga0123353_12866517 | 3300010167 | Unclassified | 563 |
| 108 | Ga0123354_10183037 | 3300010882 | Bacteria | 2382 |
| 109 | Ga0123354_10669526 | 3300010882 | Bacteria | 735 |
| 110 | Ga0223683_1030274 | 3300021245 | Bacteria | 2169 |
| 111 | Ga0415639_030022 | 3300038395 | Bacteria | 1243 |
| 112 | IMNBL1DRAFT_c0000388 | 3300000062 | Bacteria | 37738 |
| 113 | Ga0466706_029003 | 3300042599 | Bacteria | 3990 |
| 114 | Ga0466706_052107 | 3300042599 | Bacteria | 1325 |
| 115 | Ga0466714_136654 | 3300042603 | Bacteria | 17666 |
| 116 | Ga0466722_114013 | 3300042609 | Bacteria | 1422 |
| 117 | Ga0466715_551822 | 3300042616 | Bacteria | 2952 |
| 118 | Ga0466733_072199 | 3300042659 | Bacteria | 1084 |
| 119 | Ga0123357_10141579 | 3300009784 | Bacteria | 2953 |
| 120 | Ga0123355_10046667 | 3300009826 | Bacteria | 7045 |
| 121 | Ga0123355_10376551 | 3300009826 | Bacteria | 1854 |
| 122 | Ga0123355_10401955 | 3300009826 | Bacteria | 1766 |
| 123 | Ga0123355_11126502 | 3300009826 | Bacteria | 812 |
| 124 | Ga0123355_11999211 | 3300009826 | Bacteria | 537 |
| 125 | Ga0123356_11694451 | 3300010049 | Bacteria | 784 |
| 126 | Ga0123353_10137894 | 3300010167 | Bacteria | 3911 |
| 127 | Ga0123353_11175824 | 3300010167 | Bacteria | 1009 |
| 128 | Ga0123353_13366475 | 3300010167 | Bacteria | 508 |
| 129 | Ga0415639_008996 | 3300038395 | Bacteria | 14279 |
| 130 | Ga0415639_063859 | 3300038395 | Bacteria | 1268 |
| 131 | Ga0072941_1007162 | 3300005201 | Bacteria | 33370 |
| 132 | Ga0466735_208579 | 3300042624 | Bacteria | 1049 |
| 133 | Ga0466725_246848 | 3300042654 | Bacteria | 2870 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00276 | Ribosomal_L23 | Ribosomal protein L23 | 11 | 95 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.