Protein Family IF00711
Metagenome
Isolate
117
Members
51
Samples
110
Scaffolds
130.88
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10067876|JGI24695J34938_100678762
- Length
- 139 aa
- Sequence
- MAVIQRFEDLFIWQKARELCQNVFRIISYELFSKDYKLRDQMRGSSGSINNIAEGFERNGNKEFIQFLYITKGSCGETRSQLYRALDAKYINQTEFEELKTKTEYLSISIMKFIPHLQNSTMKGSKYSDNSKVQINSN*
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.9%
Kalotermitidae
13.7%
Blattidae
9.8%
Unclassified
7.8%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Passalidae
2.0%
Cambaridae
2.0%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 12 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 25 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 48 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466702_146393 | 3300042635 | Bacteria | 2163 |
| 2 | Ga0466710_166012 | 3300042613 | Bacteria | 1842 |
| 3 | Ga0466710_323960 | 3300042613 | Bacteria | 1035 |
| 4 | Ga0466710_342527 | 3300042613 | Bacteria | 2064 |
| 5 | Ga0123356_10524615 | 3300010049 | Bacteria | 1343 |
| 6 | Ga0123356_11190599 | 3300010049 | Bacteria | 928 |
| 7 | JGI24702J35022_10019603 | 3300002462 | Bacteria | 3678 |
| 8 | Ga0466732_182845 | 3300042656 | Bacteria | 4741 |
| 9 | Ga0466733_108080 | 3300042659 | Bacteria | 3620 |
| 10 | Ga0466729_212625 | 3300042621 | Bacteria | 4443 |
| 11 | Ga0466731_288311 | 3300042622 | Bacteria | 2861 |
| 12 | Ga0466709_288553 | 3300042648 | Bacteria | 15938 |
| 13 | Ga0466724_18907 | 3300042649 | Bacteria | 1322 |
| 14 | Ga0466724_45540 | 3300042649 | Bacteria | 2049 |
| 15 | Ga0466711_463911 | 3300042615 | Bacteria | 13686 |
| 16 | Ga0466729_141595 | 3300042621 | Bacteria | 5836 |
| 17 | Ga0466707_197007 | 3300042601 | Bacteria | 5115 |
| 18 | Ga0466721_149825 | 3300042608 | Bacteria | 2134 |
| 19 | Ga0466722_114854 | 3300042609 | Bacteria | 10617 |
| 20 | Ga0123356_11320215 | 3300010049 | Bacteria | 884 |
| 21 | Ga0123353_10329002 | 3300010167 | Bacteria | 2314 |
| 22 | Ga0466656_210807 | 3300042550 | Bacteria | 14276 |
| 23 | Ga0466695_346326 | 3300042595 | Bacteria | 5342 |
| 24 | Ga0466731_153559 | 3300042622 | Bacteria | 1549 |
| 25 | Ga0466725_376299 | 3300042654 | Bacteria | 12483 |
| 26 | Ga0466727_291565 | 3300042655 | Bacteria | 2518 |
| 27 | Ga0466701_036173 | 3300042598 | Bacteria | 1408 |
| 28 | Ga0123356_10001030 | 3300010049 | Bacteria | 30938 |
| 29 | Ga0123353_10451281 | 3300010167 | Bacteria | 1893 |
| 30 | Ga0123353_11532485 | 3300010167 | Bacteria | 847 |
| 31 | Ga0123354_10016587 | 3300010882 | Bacteria | 11543 |
| 32 | IMNBL1DRAFT_c0098490 | 3300000062 | Bacteria | 790 |
| 33 | Ga0466697_193799 | 3300042611 | Bacteria | 2854 |
| 34 | Ga0466727_031068 | 3300042655 | Bacteria | 2727 |
| 35 | Ga0466727_099918 | 3300042655 | Bacteria | 27215 |
| 36 | Ga0466717_267935 | 3300042604 | Bacteria | 2329 |
| 37 | Ga0466719_098583 | 3300042606 | Bacteria | 2202 |
| 38 | Ga0123356_11342739 | 3300010049 | Bacteria | 877 |
| 39 | Ga0123353_10035187 | 3300010167 | Bacteria | 7828 |
| 40 | Ga0123353_10422906 | 3300010167 | Bacteria | 1973 |
| 41 | Ga0123353_10632250 | 3300010167 | Bacteria | 1520 |
| 42 | Ga0123354_10375499 | 3300010882 | Bacteria | 1235 |
| 43 | JGI24695J34938_10067876 | 3300002450 | Bacteria | 1499 |
| 44 | JGI24702J35022_10568353 | 3300002462 | Bacteria | 700 |
| 45 | JGI24705J35276_12048957 | 3300002504 | Bacteria | 915 |
| 46 | JGI24705J35276_12158313 | 3300002504 | Bacteria | 1218 |
| 47 | JGI24696J40584_12897587 | 3300002834 | Bacteria | 1165 |
| 48 | Ga0466694_127923 | 3300042594 | Bacteria | 3536 |
| 49 | Ga0466732_065826 | 3300042656 | Bacteria | 1193 |
| 50 | Ga0466732_124237 | 3300042656 | Bacteria | 16136 |
| 51 | Ga0466734_002557 | 3300042623 | Bacteria | 1484 |
| 52 | Ga0466730_054814 | 3300042625 | Bacteria | 3724 |
| 53 | Ga0466727_236868 | 3300042655 | Bacteria | 8907 |
| 54 | Ga0466718_032438 | 3300042617 | Bacteria | 1569 |
| 55 | Ga0466697_013415 | 3300042611 | Bacteria | 1023 |
| 56 | Ga0123356_10076449 | 3300010049 | Bacteria | 3155 |
| 57 | Ga0123356_10913600 | 3300010049 | Bacteria | 1049 |
| 58 | Ga0123356_11195935 | 3300010049 | Bacteria | 926 |
| 59 | Ga0123356_12902059 | 3300010049 | Bacteria | 599 |
| 60 | Ga0123353_12387889 | 3300010167 | Bacteria | 633 |
| 61 | Ga0123354_10542647 | 3300010882 | Bacteria | 881 |
| 62 | IMNBL1DRAFT_c0095495 | 3300000062 | Bacteria | 807 |
| 63 | JGI24696J40584_12913947 | 3300002834 | Bacteria | 1281 |
| 64 | Ga0466694_133944 | 3300042594 | Bacteria | 1452 |
| 65 | Ga0466733_001214 | 3300042659 | Bacteria | 8164 |
| 66 | Ga0466733_074245 | 3300042659 | Bacteria | 6516 |
| 67 | Ga0466730_092495 | 3300042625 | Bacteria | 1229 |
| 68 | Ga0466725_088968 | 3300042654 | Bacteria | 1018 |
| 69 | Ga0466725_369481 | 3300042654 | Bacteria | 29015 |
| 70 | Ga0466727_271732 | 3300042655 | Bacteria | 1739 |
| 71 | Ga0466710_153494 | 3300042613 | Bacteria | 1005 |
| 72 | Ga0466726_403200 | 3300042619 | Bacteria | 6852 |
| 73 | Ga0466713_101286 | 3300042602 | Bacteria | 33344 |
| 74 | Ga0466719_563524 | 3300042606 | Bacteria | 2164 |
| 75 | Ga0123356_10032841 | 3300010049 | Bacteria | 4853 |
| 76 | Ga0123356_10785420 | 3300010049 | Bacteria | 1123 |
| 77 | Ga0123356_12601194 | 3300010049 | Bacteria | 634 |
| 78 | Ga0123353_10134893 | 3300010167 | Bacteria | 3959 |
| 79 | Ga0123353_10181119 | 3300010167 | Bacteria | 3335 |
| 80 | Ga0123353_13389669 | 3300010167 | Bacteria | 506 |
| 81 | Ga0466734_136237 | 3300042623 | Bacteria | 1057 |
| 82 | Ga0466715_034085 | 3300042616 | Bacteria | 9434 |
| 83 | Ga0466715_151038 | 3300042616 | Bacteria | 8575 |
| 84 | Ga0466718_094431 | 3300042617 | Bacteria | 1162 |
| 85 | Ga0466723_006036 | 3300042618 | Bacteria | 4202 |
| 86 | Ga0466700_048707 | 3300042600 | Bacteria | 13808 |
| 87 | Ga0466707_002406 | 3300042601 | Bacteria | 2530 |
| 88 | Ga0466719_255079 | 3300042606 | Bacteria | 1249 |
| 89 | Ga0123356_10014528 | 3300010049 | Bacteria | 7568 |
| 90 | Ga0123356_10052591 | 3300010049 | Bacteria | 3789 |
| 91 | Ga0123353_11731419 | 3300010167 | Bacteria | 781 |
| 92 | Ga0123354_10002221 | 3300010882 | Bacteria | 25270 |
| 93 | Ga0123354_10454318 | 3300010882 | Bacteria | 1035 |
| 94 | JGI24698J34947_10339081 | 3300002449 | Bacteria | 529 |
| 95 | Ga0466657_317878 | 3300042582 | Bacteria | 25931 |
| 96 | Ga0466693_188635 | 3300042592 | Bacteria | 1357 |
| 97 | Ga0466696_183361 | 3300042596 | Bacteria | 1462 |
| 98 | Ga0466697_067691 | 3300042611 | Bacteria | 1043 |
| 99 | Ga0466733_031701 | 3300042659 | Bacteria | 1523 |
| 100 | Ga0466731_378712 | 3300042622 | Bacteria | 2114 |
| 101 | Ga0466724_10271 | 3300042649 | Bacteria | 4118 |
| 102 | Ga0466713_072437 | 3300042602 | Bacteria | 2668 |
| 103 | Ga0466716_062974 | 3300042605 | Bacteria | 1098 |
| 104 | Ga0466697_029529 | 3300042611 | Bacteria | 1106 |
| 105 | Ga0123355_10915000 | 3300009826 | Bacteria | 950 |
| 106 | Ga0123353_10244839 | 3300010167 | Bacteria | 2783 |
| 107 | Ga0123353_11684229 | 3300010167 | Bacteria | 795 |
| 108 | Ga0068305_10251478 | 3300005083 | Bacteria | 3142 |
| 109 | Ga0466693_105323 | 3300042592 | Bacteria | 1349 |
| 110 | Ga0466696_002304 | 3300042596 | Bacteria | 6714 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05635 | 23S_rRNA_IVP | 23S rRNA-intervening sequence protein | 8 | 107 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.