Protein Family IF00705
Metagenome
Isolate
158
Members
62
Samples
155
Scaffolds
246.85
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10045238|JGI24695J34938_100452382
- Length
- 267 aa
- Sequence
- MKTTKIEWTEATWNPSIGCTKKTAGCKNCYAEIMARRLQGIGVPGYENGFEFKVLPERLQQPTTIKKPTKFFVNSMSDLFHEKMPFSYLDKVFETIKNTPQHHYQILTKREKRLQKYFEKRTVPSNVWLGVTVENASTKHRIDVLRNIEASVRFISVEPLIGDVGELDLSEIHWVIVGGESGISARPMNPEWAINVQKQCAEQDVAFFFKQWGTWGEDGVKRNKKENGNILQGKVWKEEPPILQKYQTRTIVTKKRIKSKVNLQKF*
Sample Types
Isolate
1.9%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.6%
Kalotermitidae
22.0%
Unclassified
8.5%
Termopsidae
5.1%
Rhinotermitidae
3.4%
Passalidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820151121 | Unclassified Proteobacteria Cu122P5bin52 | Isolate | Unclassified |
| 3 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 51 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_044036 | 3300042622 | Bacteria | 1055 |
| 2 | Ga0466731_144846 | 3300042622 | Bacteria | 1020 |
| 3 | Ga0466702_109383 | 3300042635 | Bacteria | 2410 |
| 4 | Ga0466703_231485 | 3300042636 | Bacteria | 5033 |
| 5 | Ga0466704_001675 | 3300042643 | Bacteria | 7568 |
| 6 | Ga0466704_351944 | 3300042643 | Bacteria | 4835 |
| 7 | Ga0466709_140267 | 3300042648 | Bacteria | 28990 |
| 8 | Ga0466708_087036 | 3300042652 | Bacteria | 3663 |
| 9 | Ga0466727_323871 | 3300042655 | Bacteria | 3411 |
| 10 | Ga0466705_404255 | 3300042612 | Bacteria | 4226 |
| 11 | Ga0466705_479437 | 3300042612 | Bacteria | 3431 |
| 12 | Ga0123353_10034596 | 3300010167 | Bacteria | 7889 |
| 13 | Ga0264413_122687 | 3300024493 | Bacteria | 3859 |
| 14 | Ga0466700_019993 | 3300042600 | Bacteria | 78233 |
| 15 | Ga0466720_008481 | 3300042607 | Bacteria | 3389 |
| 16 | Ga0466720_103456 | 3300042607 | Bacteria | 1701 |
| 17 | Ga0466722_128156 | 3300042609 | Bacteria | 2173 |
| 18 | FAAS_10001839 | 3300001880 | Bacteria | 1414 |
| 19 | JGI24702J35022_10021150 | 3300002462 | Bacteria | 3529 |
| 20 | Ga0466734_016594 | 3300042623 | Bacteria | 1468 |
| 21 | Ga0466735_202570 | 3300042624 | Bacteria | 1921 |
| 22 | Ga0466708_074707 | 3300042652 | Bacteria | 3013 |
| 23 | Ga0466711_014777 | 3300042615 | Bacteria | 4591 |
| 24 | Ga0466711_163378 | 3300042615 | Bacteria | 2990 |
| 25 | Ga0466718_150484 | 3300042617 | Bacteria | 1065 |
| 26 | Ga0466726_025681 | 3300042619 | Bacteria | 4164 |
| 27 | Ga0123353_10500739 | 3300010167 | Bacteria | 1770 |
| 28 | Ga0123353_10639428 | 3300010167 | Bacteria | 1509 |
| 29 | Ga0415639_036150 | 3300038395 | Bacteria | 10535 |
| 30 | Ga0466690_001125 | 3300042590 | Bacteria | 2961 |
| 31 | Ga0466691_071384 | 3300042593 | Bacteria | 3363 |
| 32 | Ga0466694_262403 | 3300042594 | Bacteria | 1439 |
| 33 | Ga0466716_503644 | 3300042605 | Bacteria | 2739 |
| 34 | Ga0466719_090210 | 3300042606 | Unclassified | 2222 |
| 35 | Ga0466720_130446 | 3300042607 | Bacteria | 13979 |
| 36 | Ga0466721_001716 | 3300042608 | Bacteria | 1876 |
| 37 | Ga0466698_364209 | 3300042610 | Bacteria | 2466 |
| 38 | Ga0466698_387115 | 3300042610 | Bacteria | 1562 |
| 39 | Ga0466705_014403 | 3300042612 | Bacteria | 4983 |
| 40 | Ga0466705_112072 | 3300042612 | Bacteria | 1849 |
| 41 | Ga0466705_250090 | 3300042612 | Bacteria | 2117 |
| 42 | Ga0466732_175028 | 3300042656 | Bacteria | 2535 |
| 43 | Ga0466735_193052 | 3300042624 | Bacteria | 2787 |
| 44 | Ga0466702_240393 | 3300042635 | Bacteria | 2392 |
| 45 | Ga0466702_430753 | 3300042635 | Bacteria | 1028 |
| 46 | Ga0466709_106293 | 3300042648 | Bacteria | 11933 |
| 47 | Ga0466708_402273 | 3300042652 | Bacteria | 4157 |
| 48 | Ga0466712_254826 | 3300042614 | Bacteria | 1222 |
| 49 | Ga0466711_313429 | 3300042615 | Bacteria | 90458 |
| 50 | Ga0466726_074667 | 3300042619 | Bacteria | 4046 |
| 51 | Ga0123353_10926610 | 3300010167 | Bacteria | 1182 |
| 52 | Ga0466692_189713 | 3300042591 | Bacteria | 1504 |
| 53 | Ga0466713_133937 | 3300042602 | Unclassified | 3812 |
| 54 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 55 | Ga0466697_008153 | 3300042611 | Bacteria | 1720 |
| 56 | JGI24696J40584_12922688 | 3300002834 | Unclassified | 1367 |
| 57 | JGI24696J40584_12956655 | 3300002834 | Bacteria | 3184 |
| 58 | Ga0466705_036681 | 3300042612 | Bacteria | 6392 |
| 59 | Ga0466705_327922 | 3300042612 | Bacteria | 2563 |
| 60 | Ga0466708_221792 | 3300042652 | Bacteria | 3017 |
| 61 | Ga0466711_426181 | 3300042615 | Bacteria | 3243 |
| 62 | Ga0466715_539001 | 3300042616 | Bacteria | 5818 |
| 63 | Ga0264413_109329 | 3300024493 | Bacteria | 2936 |
| 64 | Ga0466657_073071 | 3300042582 | Bacteria | 5337 |
| 65 | Ga0466690_237871 | 3300042590 | Unclassified | 2739 |
| 66 | Ga0466693_224987 | 3300042592 | Bacteria | 4346 |
| 67 | Ga0466691_070379 | 3300042593 | Bacteria | 3329 |
| 68 | Ga0466691_083314 | 3300042593 | Bacteria | 3599 |
| 69 | Ga0466691_154746 | 3300042593 | Bacteria | 5529 |
| 70 | AustNasuHG_c1000014 | 3300000089 | Bacteria | 40235 |
| 71 | AustNasuHG_c1003136 | 3300000089 | Bacteria | 5961 |
| 72 | JGI24698J34947_10000991 | 3300002449 | Bacteria | 14556 |
| 73 | Ga0072941_1064726 | 3300005201 | Bacteria | 1623 |
| 74 | Ga0466733_028490 | 3300042659 | Bacteria | 18069 |
| 75 | Ga0466731_176252 | 3300042622 | Bacteria | 4148 |
| 76 | Ga0466704_296227 | 3300042643 | Bacteria | 2909 |
| 77 | Ga0466708_060258 | 3300042652 | Bacteria | 1079 |
| 78 | Ga0466727_091785 | 3300042655 | Bacteria | 2952 |
| 79 | Ga0466715_270969 | 3300042616 | Bacteria | 10023 |
| 80 | Ga0466723_267346 | 3300042618 | Bacteria | 1979 |
| 81 | Ga0466726_227813 | 3300042619 | Bacteria | 2939 |
| 82 | Ga0466726_403200 | 3300042619 | Bacteria | 6852 |
| 83 | Ga0123354_10150434 | 3300010882 | Bacteria | 2823 |
| 84 | Ga0466657_195905 | 3300042582 | Bacteria | 1663 |
| 85 | Ga0466657_362155 | 3300042582 | Bacteria | 6947 |
| 86 | Ga0466693_328714 | 3300042592 | Bacteria | 1077 |
| 87 | Ga0466713_047417 | 3300042602 | Bacteria | 2564 |
| 88 | Ga0466716_064386 | 3300042605 | Bacteria | 2086 |
| 89 | Ga0466716_243990 | 3300042605 | Bacteria | 2123 |
| 90 | AustNasuHG_c1011397 | 3300000089 | Bacteria | 3082 |
| 91 | JGI24702J35022_10084555 | 3300002462 | Bacteria | 1722 |
| 92 | JGI24699J35502_11109404 | 3300002509 | Bacteria | 2631 |
| 93 | Ga0072940_1482549 | 3300005200 | Bacteria | 955 |
| 94 | Ga0466697_084268 | 3300042611 | Bacteria | 2378 |
| 95 | Ga0466697_106175 | 3300042611 | Bacteria | 1228 |
| 96 | Ga0466733_068626 | 3300042659 | Bacteria | 5750 |
| 97 | Ga0466731_019022 | 3300042622 | Bacteria | 1848 |
| 98 | Ga0466704_238811 | 3300042643 | Bacteria | 1183 |
| 99 | Ga0466704_442863 | 3300042643 | Bacteria | 1146 |
| 100 | Ga0466708_082533 | 3300042652 | Bacteria | 3490 |
| 101 | Ga0466710_270179 | 3300042613 | Bacteria | 1494 |
| 102 | Ga0466715_278886 | 3300042616 | Bacteria | 1662 |
| 103 | Ga0466718_123812 | 3300042617 | Bacteria | 11598 |
| 104 | Ga0123355_10000860 | 3300009826 | Bacteria | 41957 |
| 105 | Ga0123356_10244459 | 3300010049 | Bacteria | 1868 |
| 106 | Ga0123353_11340934 | 3300010167 | Bacteria | 925 |
| 107 | Ga0466690_296980 | 3300042590 | Unclassified | 1612 |
| 108 | Ga0466693_275847 | 3300042592 | Bacteria | 6823 |
| 109 | Ga0466707_053250 | 3300042601 | Bacteria | 11788 |
| 110 | Ga0466717_212651 | 3300042604 | Bacteria | 1167 |
| 111 | Ga0466716_204552 | 3300042605 | Bacteria | 1597 |
| 112 | Ga0466720_112167 | 3300042607 | Bacteria | 13198 |
| 113 | JGI24695J34938_10045238 | 3300002450 | Bacteria | 1954 |
| 114 | Ga0466697_080428 | 3300042611 | Bacteria | 1180 |
| 115 | Ga0466697_134624 | 3300042611 | Bacteria | 1204 |
| 116 | Ga0466731_113149 | 3300042622 | Bacteria | 4054 |
| 117 | Ga0466702_253270 | 3300042635 | Bacteria | 1232 |
| 118 | Ga0466703_224360 | 3300042636 | Bacteria | 2918 |
| 119 | Ga0466703_263450 | 3300042636 | Bacteria | 3167 |
| 120 | Ga0466723_215421 | 3300042618 | Bacteria | 2893 |
| 121 | Ga0466726_040311 | 3300042619 | Bacteria | 1247 |
| 122 | Ga0123356_10542136 | 3300010049 | Bacteria | 1324 |
| 123 | Ga0123356_10584299 | 3300010049 | Bacteria | 1281 |
| 124 | Ga0466656_257929 | 3300042550 | Bacteria | 1311 |
| 125 | Ga0466657_229008 | 3300042582 | Bacteria | 97233 |
| 126 | Ga0466690_046129 | 3300042590 | Unclassified | 4297 |
| 127 | Ga0466695_057067 | 3300042595 | Unclassified | 3604 |
| 128 | Ga0466696_090131 | 3300042596 | Bacteria | 1991 |
| 129 | Ga0466701_072422 | 3300042598 | Bacteria | 50719 |
| 130 | Ga0466706_244303 | 3300042599 | Bacteria | 41796 |
| 131 | Ga0466719_242968 | 3300042606 | Bacteria | 7854 |
| 132 | Ga0466720_206120 | 3300042607 | Unclassified | 3381 |
| 133 | JGI24695J34938_10002147 | 3300002450 | Bacteria | 15407 |
| 134 | JGI24702J35022_10002804 | 3300002462 | Bacteria | 10569 |
| 135 | JGI24696J40584_12959113 | 3300002834 | Bacteria | 4728 |
| 136 | Ga0466731_120213 | 3300042622 | Bacteria | 4043 |
| 137 | Ga0466710_417545 | 3300042613 | Bacteria | 3025 |
| 138 | Ga0466715_362959 | 3300042616 | Bacteria | 1653 |
| 139 | Ga0466723_250398 | 3300042618 | Bacteria | 3476 |
| 140 | Ga0466726_489063 | 3300042619 | Bacteria | 1274 |
| 141 | Ga0123356_10012806 | 3300010049 | Bacteria | 8120 |
| 142 | Ga0123356_10055926 | 3300010049 | Bacteria | 3675 |
| 143 | Ga0123356_10703127 | 3300010049 | Bacteria | 1180 |
| 144 | Ga0123353_10014069 | 3300010167 | Bacteria | 11511 |
| 145 | Ga0466691_055724 | 3300042593 | Bacteria | 5259 |
| 146 | Ga0466694_227105 | 3300042594 | Bacteria | 4226 |
| 147 | Ga0466696_049852 | 3300042596 | Bacteria | 8685 |
| 148 | Ga0466700_156257 | 3300042600 | Bacteria | 2954 |
| 149 | Ga0466720_087002 | 3300042607 | Bacteria | 2860 |
| 150 | 2227472964 | 2225789004 | Bacteria | 4788 |
| 151 | AustNasuHG_c1006976 | 3300000089 | Bacteria | 4025 |
| 152 | JGI24698J34947_10012743 | 3300002449 | Bacteria | 4601 |
| 153 | JGI24705J35276_12230889 | 3300002504 | Bacteria | 3767 |
| 154 | JGI24696J40584_12950894 | 3300002834 | Bacteria | 2189 |
| 155 | Ga0072940_1025698 | 3300005200 | Bacteria | 10052 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07505 | DUF5131 | Protein of unknown function (DUF5131) | 3 | 240 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.