Protein Family IF00675
Metagenome
Isolate
125
Members
38
Samples
109
Scaffolds
372.96
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10021750|JGI24695J34938_100217504
- Length
- 420 aa
- Sequence
- MIFDCEVGGSVAYKRKQFRIIITILLFLIYFFLAARPVPKEVILAPGWISSIESGPQTGRLLDVQAEDSEKPAGGTESQSENLSGSDYETNNDDVQYFPFTLNSRFGYIDTLGQFAVNKIITENIYLSRNMWTEYNAEPSNIEIKNILDEAIINIYNAHGYPILLDDRVFIISSDQNSLSEIDKNGNILWAYEFGAPLTCIDARAGLLLTGSLDGIIEIFNSDGERIFYFEPVGSRYAVILGCAISHDGSRIGIISGIDQQRFXLLERFGNFGGDYKVVYHEYLDTGFRRPVRILFIDDDQRIVFERTGGIGCYNIKYRRGIFIPLXGEICSVEESGDNGYFFLVTSHGNNEKKLVGIRFPPDRLLPFSVFPDADAIFLKASFKSDAVFLSRTRLHKNGSSMIVVGGGQTLISFTLEEK*
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.8%
Unclassified
44.4%
Rhinotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 4 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 11 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 15 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 16 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 24 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 25 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 30 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 31 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 35 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10001538 | 3300010049 | Bacteria | 25408 |
| 2 | Ga0123356_10080893 | 3300010049 | Bacteria | 3072 |
| 3 | Ga0123356_10148900 | 3300010049 | Bacteria | 2321 |
| 4 | Ga0466720_030542 | 3300042607 | Bacteria | 3272 |
| 5 | Ga0466702_146299 | 3300042635 | Unclassified | 23587 |
| 6 | Ga0466702_405782 | 3300042635 | Bacteria | 11326 |
| 7 | Ga0466694_319436 | 3300042594 | Bacteria | 51857 |
| 8 | Ga0466694_356566 | 3300042594 | Bacteria | 4841 |
| 9 | Ga0466712_303621 | 3300042614 | Bacteria | 20052 |
| 10 | Ga0466718_071475 | 3300042617 | Bacteria | 23698 |
| 11 | AustNasuHG_c1002395 | 3300000089 | Bacteria | 6769 |
| 12 | AustNasuHG_c1002920 | 3300000089 | Bacteria | 6161 |
| 13 | JGI24695J34938_10000069 | 3300002450 | Bacteria | 86031 |
| 14 | JGI24695J34938_10000185 | 3300002450 | Bacteria | 58369 |
| 15 | JGI24695J34938_10000591 | 3300002450 | Bacteria | 34913 |
| 16 | JGI24695J34938_10023299 | 3300002450 | Bacteria | 2988 |
| 17 | Ga0123356_10000381 | 3300010049 | Bacteria | 50607 |
| 18 | Ga0123356_10003976 | 3300010049 | Bacteria | 15353 |
| 19 | Ga0123356_10011765 | 3300010049 | Bacteria | 8516 |
| 20 | Ga0466720_107813 | 3300042607 | Bacteria | 4867 |
| 21 | Ga0466702_158960 | 3300042635 | Bacteria | 3968 |
| 22 | Ga0466694_381091 | 3300042594 | Bacteria | 1568 |
| 23 | Ga0466712_139667 | 3300042614 | Bacteria | 14921 |
| 24 | Ga0466718_096352 | 3300042617 | Bacteria | 8834 |
| 25 | JGI24698J34947_10003164 | 3300002449 | Bacteria | 8909 |
| 26 | JGI24695J34938_10000175 | 3300002450 | Bacteria | 59525 |
| 27 | Ga0123356_10004966 | 3300010049 | Bacteria | 13636 |
| 28 | Ga0123356_10107568 | 3300010049 | Bacteria | 2687 |
| 29 | Ga0466720_110757 | 3300042607 | Unclassified | 4598 |
| 30 | Ga0466702_137459 | 3300042635 | Bacteria | 1869 |
| 31 | Ga0466718_068330 | 3300042617 | Bacteria | 5699 |
| 32 | JGI24698J34947_10035324 | 3300002449 | Bacteria | 2610 |
| 33 | JGI24695J34938_10017021 | 3300002450 | Bacteria | 3676 |
| 34 | JGI24695J34938_10021750 | 3300002450 | Bacteria | 3130 |
| 35 | Ga0072940_1031879 | 3300005200 | Bacteria | 16161 |
| 36 | Ga0123356_10002094 | 3300010049 | Bacteria | 21517 |
| 37 | Ga0123356_10008238 | 3300010049 | Bacteria | 10374 |
| 38 | Ga0123356_10011317 | 3300010049 | Bacteria | 8703 |
| 39 | Ga0123353_10014494 | 3300010167 | Bacteria | 11371 |
| 40 | Ga0466700_205118 | 3300042600 | Bacteria | 3584 |
| 41 | Ga0415639_038200 | 3300038395 | Bacteria | 24274 |
| 42 | Ga0466694_011754 | 3300042594 | Bacteria | 23880 |
| 43 | Ga0466694_287761 | 3300042594 | Bacteria | 4748 |
| 44 | Ga0466694_309810 | 3300042594 | Bacteria | 3903 |
| 45 | Ga0466699_009486 | 3300042597 | Bacteria | 4751 |
| 46 | JGI24695J34938_10000338 | 3300002450 | Bacteria | 46275 |
| 47 | JGI24695J34938_10000366 | 3300002450 | Bacteria | 44825 |
| 48 | JGI24695J34938_10001859 | 3300002450 | Bacteria | 17150 |
| 49 | JGI24695J34938_10005324 | 3300002450 | Bacteria | 8065 |
| 50 | JGI24695J34938_10044969 | 3300002450 | Bacteria | 1961 |
| 51 | Ga0123356_10005193 | 3300010049 | Bacteria | 13316 |
| 52 | Ga0123356_10052621 | 3300010049 | Bacteria | 3788 |
| 53 | Ga0123356_10157598 | 3300010049 | Bacteria | 2263 |
| 54 | Ga0123353_10011880 | 3300010167 | Unclassified | 12311 |
| 55 | Ga0123353_10073324 | 3300010167 | Bacteria | 5502 |
| 56 | Ga0466720_033328 | 3300042607 | Bacteria | 4600 |
| 57 | Ga0466720_110593 | 3300042607 | Bacteria | 7870 |
| 58 | Ga0466702_144551 | 3300042635 | Bacteria | 3181 |
| 59 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 60 | Ga0466694_165234 | 3300042594 | Bacteria | 4755 |
| 61 | Ga0466694_258756 | 3300042594 | Bacteria | 5494 |
| 62 | Ga0466699_226179 | 3300042597 | Bacteria | 2033 |
| 63 | Ga0466718_058741 | 3300042617 | Bacteria | 19720 |
| 64 | AustNasuHG_c1013688 | 3300000089 | Bacteria | 2776 |
| 65 | JGI24695J34938_10001200 | 3300002450 | Bacteria | 22953 |
| 66 | JGI24695J34938_10002448 | 3300002450 | Bacteria | 14189 |
| 67 | JGI24695J34938_10013228 | 3300002450 | Bacteria | 4341 |
| 68 | Ga0074263_113222 | 3300005485 | Unclassified | 3609 |
| 69 | Ga0123356_10014403 | 3300010049 | Bacteria | 7604 |
| 70 | Ga0123356_10029658 | 3300010049 | Bacteria | 5122 |
| 71 | Ga0123353_10662642 | 3300010167 | Bacteria | 1474 |
| 72 | Ga0466720_196277 | 3300042607 | Bacteria | 2817 |
| 73 | Ga0466702_112085 | 3300042635 | Bacteria | 6166 |
| 74 | Ga0466702_266574 | 3300042635 | Bacteria | 3079 |
| 75 | Ga0264413_104349 | 3300024493 | Unclassified | 2854 |
| 76 | Ga0466694_152393 | 3300042594 | Bacteria | 16469 |
| 77 | Ga0466718_004615 | 3300042617 | Bacteria | 2307 |
| 78 | Ga0466718_147455 | 3300042617 | Bacteria | 4392 |
| 79 | JGI24698J34947_10000233 | 3300002449 | Bacteria | 23039 |
| 80 | JGI24695J34938_10000320 | 3300002450 | Bacteria | 47216 |
| 81 | JGI24695J34938_10002590 | 3300002450 | Bacteria | 13622 |
| 82 | JGI24695J34938_10003404 | 3300002450 | Bacteria | 11150 |
| 83 | JGI24695J34938_10009105 | 3300002450 | Bacteria | 5558 |
| 84 | JGI24699J35502_11108204 | 3300002509 | Bacteria | 2587 |
| 85 | Ga0123355_10014171 | 3300009826 | Bacteria | 12448 |
| 86 | Ga0466721_104626 | 3300042608 | Bacteria | 3018 |
| 87 | Ga0264413_113988 | 3300024493 | Bacteria | 2586 |
| 88 | Ga0415639_022059 | 3300038395 | Bacteria | 4722 |
| 89 | Ga0466694_203518 | 3300042594 | Bacteria | 1798 |
| 90 | Ga0466712_197122 | 3300042614 | Bacteria | 6897 |
| 91 | Ga0466718_008882 | 3300042617 | Bacteria | 3384 |
| 92 | Ga0466718_135821 | 3300042617 | Bacteria | 16584 |
| 93 | JGI24698J34947_10017616 | 3300002449 | Bacteria | 3868 |
| 94 | JGI24695J34938_10000089 | 3300002450 | Bacteria | 79818 |
| 95 | JGI24695J34938_10000142 | 3300002450 | Bacteria | 65463 |
| 96 | JGI24695J34938_10002468 | 3300002450 | Bacteria | 14119 |
| 97 | JGI24695J34938_10002498 | 3300002450 | Bacteria | 13994 |
| 98 | Ga0072941_1034430 | 3300005201 | Bacteria | 15691 |
| 99 | Ga0072941_1226401 | 3300005201 | Bacteria | 2490 |
| 100 | Ga0123357_10002329 | 3300009784 | Bacteria | 21101 |
| 101 | Ga0123356_10000377 | 3300010049 | Bacteria | 50708 |
| 102 | Ga0456237_0004730 | 3300041968 | Bacteria | 2180 |
| 103 | Ga0466718_012939 | 3300042617 | Bacteria | 16746 |
| 104 | AustNasuHG_c1015303 | 3300000089 | Bacteria | 2591 |
| 105 | JGI24695J34938_10000977 | 3300002450 | Bacteria | 25996 |
| 106 | JGI24695J34938_10005054 | 3300002450 | Bacteria | 8382 |
| 107 | Ga0072941_1001161 | 3300005201 | Bacteria | 23690 |
| 108 | Ga0072941_1003891 | 3300005201 | Bacteria | 16389 |
| 109 | Ga0072941_1009062 | 3300005201 | Bacteria | 17165 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.