Protein Family IF00659
Metagenome
Isolate
175
Members
103
Samples
129
Scaffolds
279.03
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10013773|JGI24695J34938_100137733
- Length
- 322 aa
- Sequence
- VPSAPFFEVFQIRSAYYREDKIDTIGRNGWKIIQNRLECRENVRIVFPSMNNPIHVGQYRCGEGENLLLIAGPCTLQAEYNNVIAEELARLNDRLPVNVVFKGSFDKANRSSIETARGCGLEAGLEMLAXXRSQTGLPVTTDIHETCQADPVGKVCDLIQIPAFLSRQTDLLVTAAKTGKPVHVKKGQFMAPQEMRNVVRKLEESGCQDILLCERGTFFGYGRLVNDMQSLAIMREFGVPICFDATHSVQEPGGQGTFTGGNRRMVEPLARSATAVGIDALFLETHPEPAKSPSDAANMLPLDQLERVLTKILHIREALVR*
Sample Types
Isolate
26.3%
Metagenome
73.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.7%
Apidae
19.8%
Unclassified
18.8%
Kalotermitidae
13.9%
Formicidae
5.9%
Elmidae
4.0%
Culicidae
3.0%
Termopsidae
3.0%
Armadillidiidae
1.0%
Blattidae
1.0%
Daphniidae
1.0%
Nephropidae
1.0%
Ixodidae
1.0%
Rhinotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 2 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 3 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 9 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 10 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 11 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 12 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 13 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 14 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 17 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 27 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 28 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 29 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 30 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 31 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 32 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 33 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 34 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 35 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 36 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 39 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 40 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 44 | 650716015 | Candidatus Midichloria mitochondrii IricVA | Isolate | Ixodidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 53 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 54 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 55 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 60 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 61 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 62 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 63 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 64 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 65 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 66 | 2820200053 | Unclassified Planctomycetes Cu122P5bin40 | Isolate | Unclassified |
| 67 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 68 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 71 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 72 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 78 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 79 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 80 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 81 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 82 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 83 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 84 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 85 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 86 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 87 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 88 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 89 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 90 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 91 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 92 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 93 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 94 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 95 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 96 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 97 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 98 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 99 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 100 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 101 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 102 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 103 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_075007 | 3300042614 | Bacteria | 3268 |
| 2 | Ga0466711_485012 | 3300042615 | Bacteria | 2610 |
| 3 | Ga0466718_140246 | 3300042617 | Bacteria | 2217 |
| 4 | Ga0466726_250417 | 3300042619 | Bacteria | 14283 |
| 5 | Ga0466729_141377 | 3300042621 | Bacteria | 4112 |
| 6 | Ga0466729_174297 | 3300042621 | Bacteria | 16166 |
| 7 | Ga0123355_10190995 | 3300009826 | Bacteria | 3016 |
| 8 | Ga0123355_10335823 | 3300009826 | Unclassified | 2019 |
| 9 | Ga0123355_10494051 | 3300009826 | Bacteria | 1514 |
| 10 | Ga0123356_10013330 | 3300010049 | Bacteria | 7941 |
| 11 | Ga0123356_10021803 | 3300010049 | Bacteria | 6047 |
| 12 | Ga0123356_10086590 | 3300010049 | Bacteria | 2974 |
| 13 | Ga0123356_10351256 | 3300010049 | Unclassified | 1598 |
| 14 | Ga0123356_10380286 | 3300010049 | Bacteria | 1544 |
| 15 | Ga0123353_10442914 | 3300010167 | Bacteria | 1915 |
| 16 | JGI24705J35276_12236395 | 3300002504 | Bacteria | 7984 |
| 17 | Ga0072940_1219999 | 3300005200 | Bacteria | 1830 |
| 18 | Ga0466708_075908 | 3300042652 | Bacteria | 8550 |
| 19 | Ga0466708_139554 | 3300042652 | Bacteria | 28818 |
| 20 | Ga0466690_252916 | 3300042590 | Bacteria | 1175 |
| 21 | Ga0466696_021254 | 3300042596 | Bacteria | 8360 |
| 22 | Ga0466711_513243 | 3300042615 | Bacteria | 5692 |
| 23 | Ga0466715_423249 | 3300042616 | Bacteria | 1442 |
| 24 | Ga0123355_10466992 | 3300009826 | Bacteria | 1580 |
| 25 | Ga0123355_10724342 | 3300009826 | Bacteria | 1134 |
| 26 | Ga0123353_10149739 | 3300010167 | Bacteria | 3727 |
| 27 | Ga0123353_10893436 | 3300010167 | Bacteria | 1211 |
| 28 | Ga0466700_346509 | 3300042600 | Bacteria | 3644 |
| 29 | Ga0466716_113101 | 3300042605 | Bacteria | 5015 |
| 30 | Ga0466719_078707 | 3300042606 | Bacteria | 4392 |
| 31 | Ga0466731_284410 | 3300042622 | Bacteria | 1450 |
| 32 | Ga0466703_204906 | 3300042636 | Bacteria | 14838 |
| 33 | Ga0466704_331087 | 3300042643 | Bacteria | 21912 |
| 34 | Ga0466727_132397 | 3300042655 | Bacteria | 1261 |
| 35 | Ga0160433_100168 | 3300012846 | Bacteria | 55205 |
| 36 | Ga0466693_171816 | 3300042592 | Bacteria | 1083 |
| 37 | Ga0466705_278288 | 3300042612 | Bacteria | 1698 |
| 38 | Ga0466705_286349 | 3300042612 | Bacteria | 1287 |
| 39 | Ga0466733_092461 | 3300042659 | Bacteria | 2574 |
| 40 | Ga0123353_10129227 | 3300010167 | Bacteria | 4056 |
| 41 | Ga0123353_10518890 | 3300010167 | Unclassified | 1729 |
| 42 | Ga0466717_261443 | 3300042604 | Unclassified | 1406 |
| 43 | JGI24702J35022_10025836 | 3300002462 | Bacteria | 3167 |
| 44 | JGI24702J35022_10048418 | 3300002462 | Bacteria | 2263 |
| 45 | CVPL010L_1000030 | 3300002932 | Bacteria | 49452 |
| 46 | Ga0466734_023074 | 3300042623 | Bacteria | 1444 |
| 47 | Ga0466702_027754 | 3300042635 | Bacteria | 2160 |
| 48 | Ga0466704_071662 | 3300042643 | Bacteria | 2168 |
| 49 | Ga0466709_363668 | 3300042648 | Bacteria | 46373 |
| 50 | Ga0466690_117640 | 3300042590 | Bacteria | 4497 |
| 51 | Ga0466690_343571 | 3300042590 | Bacteria | 3835 |
| 52 | Ga0466729_152309 | 3300042621 | Bacteria | 4130 |
| 53 | Ga0123356_10149551 | 3300010049 | Bacteria | 2316 |
| 54 | Ga0123356_10246694 | 3300010049 | Bacteria | 1860 |
| 55 | Ga0123356_10794107 | 3300010049 | Bacteria | 1118 |
| 56 | Ga0123353_10024170 | 3300010167 | Bacteria | 9219 |
| 57 | JGI24695J34938_10013773 | 3300002450 | Unclassified | 4230 |
| 58 | JGI24695J34938_10024568 | 3300002450 | Unclassified | 2892 |
| 59 | Ga0068302_10731243 | 3300005071 | Bacteria | 1920 |
| 60 | Ga0466734_013204 | 3300042623 | Bacteria | 7120 |
| 61 | Ga0466703_184876 | 3300042636 | Bacteria | 9678 |
| 62 | Ga0466704_005447 | 3300042643 | Bacteria | 2864 |
| 63 | Ga0466725_325885 | 3300042654 | Bacteria | 1518 |
| 64 | Ga0415639_117007 | 3300038395 | Bacteria | 3108 |
| 65 | Ga0466691_148457 | 3300042593 | Bacteria | 3313 |
| 66 | Ga0466723_065360 | 3300042618 | Bacteria | 25532 |
| 67 | Ga0123355_10404929 | 3300009826 | Bacteria | 1756 |
| 68 | Ga0123356_10027004 | 3300010049 | Bacteria | 5382 |
| 69 | Ga0123356_10256243 | 3300010049 | Bacteria | 1830 |
| 70 | Ga0123356_10269914 | 3300010049 | Bacteria | 1790 |
| 71 | Ga0123353_10274187 | 3300010167 | Bacteria | 2596 |
| 72 | Ga0123353_10433077 | 3300010167 | Unclassified | 1944 |
| 73 | Ga0123353_10655688 | 3300010167 | Bacteria | 1485 |
| 74 | Ga0466698_100835 | 3300042610 | Bacteria | 1549 |
| 75 | HBC_ctgsDRAFT_1048370 | 3300000333 | Unclassified | 1035 |
| 76 | CVPL005L_10005514 | 3300002938 | Bacteria | 17405 |
| 77 | Ga0072941_1090411 | 3300005201 | Bacteria | 3245 |
| 78 | Ga0074278_109825 | 3300005721 | Bacteria | 6807 |
| 79 | Ga0102738_1000035 | 3300007141 | Bacteria | 64841 |
| 80 | Ga0466731_287274 | 3300042622 | Bacteria | 1230 |
| 81 | Ga0466708_082549 | 3300042652 | Bacteria | 53797 |
| 82 | Ga0466727_041196 | 3300042655 | Bacteria | 1145 |
| 83 | Ga0466695_117967 | 3300042595 | Bacteria | 1654 |
| 84 | Ga0466695_309017 | 3300042595 | Bacteria | 1600 |
| 85 | Ga0466705_118047 | 3300042612 | Bacteria | 5621 |
| 86 | Ga0466715_055281 | 3300042616 | Bacteria | 15597 |
| 87 | Ga0466715_077095 | 3300042616 | Bacteria | 15607 |
| 88 | Ga0466728_340280 | 3300042620 | Unclassified | 1227 |
| 89 | Ga0123355_10641395 | 3300009826 | Bacteria | 1243 |
| 90 | Ga0123356_10016826 | 3300010049 | Bacteria | 6968 |
| 91 | Ga0123356_10278139 | 3300010049 | Bacteria | 1767 |
| 92 | Ga0123353_10022160 | 3300010167 | Unclassified | 9563 |
| 93 | Ga0123353_10336140 | 3300010167 | Bacteria | 2284 |
| 94 | Ga0466701_021287 | 3300042598 | Bacteria | 3538 |
| 95 | Ga0466719_234214 | 3300042606 | Bacteria | 1472 |
| 96 | Ga0068305_10076322 | 3300005083 | Bacteria | 7159 |
| 97 | Ga0466730_072036 | 3300042625 | Unclassified | 1139 |
| 98 | Ga0466704_397751 | 3300042643 | Bacteria | 1282 |
| 99 | Ga0466704_419647 | 3300042643 | Bacteria | 2280 |
| 100 | Ga0160446_100072 | 3300012835 | Bacteria | 99052 |
| 101 | Ga0466699_150917 | 3300042597 | Bacteria | 1035 |
| 102 | Ga0466712_318023 | 3300042614 | Bacteria | 1064 |
| 103 | Ga0123353_10644998 | 3300010167 | Bacteria | 1501 |
| 104 | Ga0466700_385193 | 3300042600 | Bacteria | 1583 |
| 105 | Ga0466707_383883 | 3300042601 | Bacteria | 2518 |
| 106 | Ga0466717_075384 | 3300042604 | Bacteria | 3567 |
| 107 | Ga0466717_235208 | 3300042604 | Bacteria | 1201 |
| 108 | Ga0466721_207457 | 3300042608 | Unclassified | 3858 |
| 109 | JGI24702J35022_10007329 | 3300002462 | Bacteria | 6333 |
| 110 | Ga0074278_136386 | 3300005721 | Bacteria | 43260 |
| 111 | Ga0123357_10001267 | 3300009784 | Bacteria | 26584 |
| 112 | Ga0466703_380674 | 3300042636 | Bacteria | 2214 |
| 113 | Ga0466704_051573 | 3300042643 | Bacteria | 36056 |
| 114 | Ga0160460_100102 | 3300012845 | Bacteria | 116929 |
| 115 | Ga0316159_10558 | 3300030930 | Bacteria | 9892 |
| 116 | Ga0466657_238785 | 3300042582 | Bacteria | 19833 |
| 117 | Ga0466696_019210 | 3300042596 | Bacteria | 1288 |
| 118 | Ga0466726_408669 | 3300042619 | Bacteria | 10614 |
| 119 | Ga0466729_007162 | 3300042621 | Bacteria | 4578 |
| 120 | Ga0123356_10084590 | 3300010049 | Unclassified | 3007 |
| 121 | Ga0123356_10322050 | 3300010049 | Bacteria | 1659 |
| 122 | Ga0123353_10000736 | 3300010167 | Bacteria | 39970 |
| 123 | Ga0123353_10036867 | 3300010167 | Bacteria | 7664 |
| 124 | Ga0123353_10402052 | 3300010167 | Bacteria | 2038 |
| 125 | Ga0466707_147722 | 3300042601 | Bacteria | 5064 |
| 126 | Ga0160459_100812 | 3300012831 | Bacteria | 10127 |
| 127 | Ga0160460_100521 | 3300012845 | Bacteria | 21830 |
| 128 | Ga0309903_100005 | 3300029809 | Bacteria | 95692 |
| 129 | Ga0466696_018952 | 3300042596 | Unclassified | 3822 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00793 | DAHP_synth_1 | DAHP synthetase I family | 58 | 312 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00793 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.