Protein Family IF00648
Metagenome
Isolate
207
Members
49
Samples
205
Scaffolds
129.3
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10010541|JGI24695J34938_100105414
- Length
- 152 aa
- Sequence
- MIISLSITVICIIIVLYSRRSKYIKIELYTFCDFAQENGGKLTIVGTFDTIISRNFPCVHPQLSVVIRLRFDLWEFGPHVFRIETRDLNGEMSMDTINGNIDVKGVGNASAVSHLVFSISNLHIKTAGLVNFVLFIDDKELDCIPLYIRKG*
Sample Types
Isolate
1.0%
Metagenome
99.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
30.4%
Rhinotermitidae
8.7%
Unclassified
8.7%
Termopsidae
6.5%
Taxonomy
Archaea
1
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_121835 | 3300042601 | Bacteria | 1424 |
| 2 | Ga0466716_465270 | 3300042605 | Bacteria | 18456 |
| 3 | Ga0466716_477341 | 3300042605 | Bacteria | 2670 |
| 4 | Ga0466719_118850 | 3300042606 | Bacteria | 22662 |
| 5 | Ga0466719_337352 | 3300042606 | Bacteria | 57418 |
| 6 | Ga0123355_10107765 | 3300009826 | Bacteria | 4364 |
| 7 | Ga0123356_10042007 | 3300010049 | Bacteria | 4261 |
| 8 | Ga0466733_162511 | 3300042659 | Bacteria | 2408 |
| 9 | Ga0466703_122118 | 3300042636 | Bacteria | 7863 |
| 10 | Ga0466704_554921 | 3300042643 | Unclassified | 4539 |
| 11 | Ga0466709_229356 | 3300042648 | Bacteria | 10871 |
| 12 | Ga0466708_351249 | 3300042652 | Bacteria | 2167 |
| 13 | Ga0466727_017418 | 3300042655 | Unclassified | 1009 |
| 14 | Ga0466692_016332 | 3300042591 | Bacteria | 2472 |
| 15 | Ga0466692_064148 | 3300042591 | Bacteria | 1226 |
| 16 | Ga0466692_204518 | 3300042591 | Bacteria | 2851 |
| 17 | Ga0466696_214866 | 3300042596 | Bacteria | 5147 |
| 18 | Ga0466699_020478 | 3300042597 | Bacteria | 1778 |
| 19 | Ga0466712_039644 | 3300042614 | Unclassified | 1198 |
| 20 | Ga0466712_067544 | 3300042614 | Bacteria | 41898 |
| 21 | Ga0466711_459926 | 3300042615 | Bacteria | 4935 |
| 22 | Ga0466715_366139 | 3300042616 | Bacteria | 6739 |
| 23 | Ga0466723_013084 | 3300042618 | Bacteria | 46806 |
| 24 | Ga0466723_096331 | 3300042618 | Bacteria | 1855 |
| 25 | Ga0466728_248550 | 3300042620 | Bacteria | 8561 |
| 26 | JGI24695J34938_10514744 | 3300002450 | Bacteria | 548 |
| 27 | Ga0466716_286186 | 3300042605 | Bacteria | 3099 |
| 28 | Ga0466719_042007 | 3300042606 | Bacteria | 4651 |
| 29 | Ga0466722_035141 | 3300042609 | Bacteria | 4609 |
| 30 | Ga0466722_047181 | 3300042609 | Bacteria | 1162 |
| 31 | Ga0466697_046843 | 3300042611 | Bacteria | 1088 |
| 32 | Ga0123355_10165575 | 3300009826 | Bacteria | 3319 |
| 33 | Ga0123356_10857221 | 3300010049 | Bacteria | 1080 |
| 34 | Ga0123356_12252688 | 3300010049 | Bacteria | 681 |
| 35 | Ga0123353_10249731 | 3300010167 | Unclassified | 2749 |
| 36 | Ga0466705_383538 | 3300042612 | Archaea | 6691 |
| 37 | Ga0466732_183960 | 3300042656 | Unclassified | 3848 |
| 38 | Ga0466704_109325 | 3300042643 | Unclassified | 3736 |
| 39 | Ga0466708_169899 | 3300042652 | Unclassified | 4323 |
| 40 | Ga0264413_105605 | 3300024493 | Bacteria | 26648 |
| 41 | Ga0456237_0001592 | 3300041968 | Bacteria | 3628 |
| 42 | Ga0466693_092677 | 3300042592 | Bacteria | 3170 |
| 43 | Ga0466691_073296 | 3300042593 | Bacteria | 10858 |
| 44 | Ga0466696_264353 | 3300042596 | Bacteria | 17245 |
| 45 | Ga0466696_266622 | 3300042596 | Bacteria | 28910 |
| 46 | Ga0466699_209943 | 3300042597 | Bacteria | 1238 |
| 47 | Ga0466705_502352 | 3300042612 | Bacteria | 2287 |
| 48 | Ga0466712_023907 | 3300042614 | Unclassified | 9666 |
| 49 | Ga0466723_363983 | 3300042618 | Bacteria | 10551 |
| 50 | Ga0466726_103367 | 3300042619 | Bacteria | 25672 |
| 51 | Ga0466726_402041 | 3300042619 | Bacteria | 11507 |
| 52 | Ga0466726_435290 | 3300042619 | Bacteria | 2249 |
| 53 | AustNasuHG_c1008770 | 3300000089 | Bacteria | 3576 |
| 54 | JGI24698J34947_10000136 | 3300002449 | Bacteria | 27310 |
| 55 | JGI24698J34947_10097148 | 3300002449 | Bacteria | 1335 |
| 56 | JGI24702J35022_10097883 | 3300002462 | Bacteria | 1603 |
| 57 | JGI24702J35022_10189491 | 3300002462 | Bacteria | 1172 |
| 58 | Ga0123356_10088853 | 3300010049 | Bacteria | 2939 |
| 59 | Ga0123356_13194820 | 3300010049 | Bacteria | 570 |
| 60 | Ga0466705_080052 | 3300042612 | Unclassified | 1333 |
| 61 | Ga0466735_042871 | 3300042624 | Bacteria | 1461 |
| 62 | Ga0466703_272534 | 3300042636 | Unclassified | 2822 |
| 63 | Ga0466704_232004 | 3300042643 | Bacteria | 2260 |
| 64 | Ga0466704_279783 | 3300042643 | Unclassified | 4621 |
| 65 | Ga0466709_238050 | 3300042648 | Bacteria | 17478 |
| 66 | Ga0466708_085674 | 3300042652 | Unclassified | 1509 |
| 67 | Ga0466708_144615 | 3300042652 | Bacteria | 2736 |
| 68 | Ga0466690_059381 | 3300042590 | Bacteria | 6946 |
| 69 | Ga0466690_340872 | 3300042590 | Bacteria | 5097 |
| 70 | Ga0466690_427641 | 3300042590 | Bacteria | 1365 |
| 71 | Ga0466696_043916 | 3300042596 | Bacteria | 5371 |
| 72 | Ga0466696_335936 | 3300042596 | Bacteria | 3820 |
| 73 | Ga0466699_324577 | 3300042597 | Bacteria | 4740 |
| 74 | Ga0466718_090015 | 3300042617 | Bacteria | 1046 |
| 75 | Ga0466723_145485 | 3300042618 | Unclassified | 5957 |
| 76 | Ga0466723_366152 | 3300042618 | Bacteria | 2601 |
| 77 | Ga0466726_286228 | 3300042619 | Bacteria | 3832 |
| 78 | Ga0466728_033981 | 3300042620 | Unclassified | 1660 |
| 79 | AustNasuHG_c1059167 | 3300000089 | Unclassified | 753 |
| 80 | JGI24698J34947_10329989 | 3300002449 | Bacteria | 540 |
| 81 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 82 | JGI24695J34938_10044742 | 3300002450 | Unclassified | 1967 |
| 83 | JGI24695J34938_10050445 | 3300002450 | Bacteria | 1825 |
| 84 | JGI24695J34938_10235101 | 3300002450 | Bacteria | 773 |
| 85 | JGI24700J35501_10930731 | 3300002508 | Bacteria | 20677 |
| 86 | Ga0466719_153055 | 3300042606 | Unclassified | 3043 |
| 87 | Ga0466719_264636 | 3300042606 | Bacteria | 2308 |
| 88 | Ga0466735_115703 | 3300042624 | Bacteria | 2761 |
| 89 | Ga0466703_138166 | 3300042636 | Bacteria | 7519 |
| 90 | Ga0466703_169784 | 3300042636 | Bacteria | 10007 |
| 91 | Ga0466709_294203 | 3300042648 | Bacteria | 4723 |
| 92 | Ga0466708_290488 | 3300042652 | Bacteria | 17259 |
| 93 | Ga0265387_1107787 | 3300024582 | Bacteria | 588 |
| 94 | Ga0466690_374176 | 3300042590 | Bacteria | 5685 |
| 95 | Ga0466694_296103 | 3300042594 | Bacteria | 2223 |
| 96 | Ga0466696_245228 | 3300042596 | Bacteria | 3617 |
| 97 | Ga0466699_029285 | 3300042597 | Bacteria | 2154 |
| 98 | Ga0466699_432863 | 3300042597 | Bacteria | 9292 |
| 99 | Ga0466712_079939 | 3300042614 | Unclassified | 2960 |
| 100 | Ga0466715_008648 | 3300042616 | Unclassified | 1768 |
| 101 | Ga0466718_091409 | 3300042617 | Bacteria | 6701 |
| 102 | Ga0466723_014195 | 3300042618 | Bacteria | 19999 |
| 103 | Ga0466726_055485 | 3300042619 | Bacteria | 1325 |
| 104 | Ga0466726_108854 | 3300042619 | Bacteria | 7614 |
| 105 | Ga0466726_122714 | 3300042619 | Bacteria | 1912 |
| 106 | Ga0466726_388087 | 3300042619 | Bacteria | 2900 |
| 107 | AustNasuHG_c1001055 | 3300000089 | Bacteria | 9904 |
| 108 | JGI24698J34947_10002027 | 3300002449 | Bacteria | 10801 |
| 109 | JGI24698J34947_10299492 | 3300002449 | Bacteria | 580 |
| 110 | JGI24695J34938_10011850 | 3300002450 | Bacteria | 4664 |
| 111 | JGI24695J34938_10021045 | 3300002450 | Unclassified | 3199 |
| 112 | JGI24702J35022_10336996 | 3300002462 | Unclassified | 898 |
| 113 | JGI24696J40584_12916182 | 3300002834 | Bacteria | 1301 |
| 114 | Ga0072941_1028005 | 3300005201 | Unclassified | 3915 |
| 115 | Ga0466716_095738 | 3300042605 | Unclassified | 4086 |
| 116 | Ga0466698_089043 | 3300042610 | Bacteria | 1025 |
| 117 | Ga0123353_10316787 | 3300010167 | Bacteria | 2370 |
| 118 | Ga0123353_10329763 | 3300010167 | Bacteria | 2311 |
| 119 | Ga0123353_10998440 | 3300010167 | Bacteria | 1125 |
| 120 | Ga0466729_274504 | 3300042621 | Bacteria | 3002 |
| 121 | Ga0466735_187051 | 3300042624 | Bacteria | 1088 |
| 122 | Ga0466704_041539 | 3300042643 | Unclassified | 5277 |
| 123 | Ga0466704_089071 | 3300042643 | Unclassified | 3299 |
| 124 | Ga0466708_238878 | 3300042652 | Bacteria | 2471 |
| 125 | Ga0466692_125006 | 3300042591 | Bacteria | 40169 |
| 126 | Ga0466691_001169 | 3300042593 | Bacteria | 37215 |
| 127 | Ga0466696_242774 | 3300042596 | Unclassified | 5694 |
| 128 | Ga0466699_065159 | 3300042597 | Bacteria | 20301 |
| 129 | Ga0466711_454474 | 3300042615 | Bacteria | 8344 |
| 130 | AustNasuHG_c1002939 | 3300000089 | Bacteria | 6136 |
| 131 | JGI24695J34938_10003913 | 3300002450 | Bacteria | 10069 |
| 132 | JGI24695J34938_10010541 | 3300002450 | Bacteria | 5048 |
| 133 | JGI24695J34938_10024863 | 3300002450 | Unclassified | 2871 |
| 134 | JGI24696J40584_12562300 | 3300002834 | Bacteria | 633 |
| 135 | Ga0068305_10171527 | 3300005083 | Bacteria | 11561 |
| 136 | Ga0072941_1001014 | 3300005201 | Bacteria | 35346 |
| 137 | Ga0466719_157876 | 3300042606 | Bacteria | 4952 |
| 138 | Ga0466705_134988 | 3300042612 | Unclassified | 3973 |
| 139 | Ga0466705_268023 | 3300042612 | Bacteria | 9430 |
| 140 | Ga0466703_086868 | 3300042636 | Bacteria | 25016 |
| 141 | Ga0466704_267972 | 3300042643 | Bacteria | 8098 |
| 142 | Ga0466704_288691 | 3300042643 | Bacteria | 25350 |
| 143 | Ga0466704_363982 | 3300042643 | Unclassified | 11277 |
| 144 | Ga0466704_387350 | 3300042643 | Unclassified | 9998 |
| 145 | Ga0466704_410058 | 3300042643 | Bacteria | 4116 |
| 146 | Ga0466708_035070 | 3300042652 | Bacteria | 8052 |
| 147 | Ga0466696_079687 | 3300042596 | Bacteria | 20019 |
| 148 | Ga0466699_257370 | 3300042597 | Bacteria | 15379 |
| 149 | Ga0466711_126126 | 3300042615 | Bacteria | 2043 |
| 150 | Ga0466715_199232 | 3300042616 | Bacteria | 1809 |
| 151 | Ga0466715_604498 | 3300042616 | Bacteria | 2631 |
| 152 | Ga0466718_132997 | 3300042617 | Bacteria | 1059 |
| 153 | Ga0466723_160671 | 3300042618 | Bacteria | 9345 |
| 154 | Ga0466726_359522 | 3300042619 | Bacteria | 1237 |
| 155 | JGI24698J34947_10000153 | 3300002449 | Bacteria | 26364 |
| 156 | JGI24698J34947_10010236 | 3300002449 | Unclassified | 5142 |
| 157 | JGI24695J34938_10000015 | 3300002450 | Bacteria | 118711 |
| 158 | JGI24695J34938_10094031 | 3300002450 | Bacteria | 1228 |
| 159 | JGI24702J35022_10002475 | 3300002462 | Bacteria | 11275 |
| 160 | JGI24705J35276_11581836 | 3300002504 | Bacteria | 584 |
| 161 | Ga0072940_1488940 | 3300005200 | Unclassified | 1083 |
| 162 | Ga0466707_350740 | 3300042601 | Bacteria | 1279 |
| 163 | Ga0466716_142215 | 3300042605 | Bacteria | 16554 |
| 164 | Ga0466719_113329 | 3300042606 | Unclassified | 6219 |
| 165 | Ga0466722_177742 | 3300042609 | Bacteria | 3848 |
| 166 | Ga0466705_014231 | 3300042612 | Bacteria | 7630 |
| 167 | Ga0466705_281334 | 3300042612 | Bacteria | 2243 |
| 168 | Ga0466705_298492 | 3300042612 | Unclassified | 5911 |
| 169 | Ga0466703_021826 | 3300042636 | Bacteria | 16161 |
| 170 | Ga0466704_088341 | 3300042643 | Bacteria | 10483 |
| 171 | Ga0466704_130990 | 3300042643 | Bacteria | 4474 |
| 172 | Ga0466704_161322 | 3300042643 | Bacteria | 4138 |
| 173 | Ga0466709_241823 | 3300042648 | Unclassified | 1591 |
| 174 | Ga0466708_056502 | 3300042652 | Bacteria | 33607 |
| 175 | Ga0466727_063871 | 3300042655 | Bacteria | 1784 |
| 176 | Ga0466690_100544 | 3300042590 | Bacteria | 13391 |
| 177 | Ga0466690_264197 | 3300042590 | Bacteria | 5270 |
| 178 | Ga0466712_187668 | 3300042614 | Bacteria | 25579 |
| 179 | Ga0466711_187823 | 3300042615 | Bacteria | 1806 |
| 180 | Ga0466723_009818 | 3300042618 | Bacteria | 36345 |
| 181 | Ga0466723_305681 | 3300042618 | Bacteria | 8089 |
| 182 | Ga0466726_216941 | 3300042619 | Bacteria | 5119 |
| 183 | Ga0466726_241519 | 3300042619 | Bacteria | 6979 |
| 184 | Ga0466726_269039 | 3300042619 | Bacteria | 1055 |
| 185 | JGI24695J34938_10012150 | 3300002450 | Bacteria | 4585 |
| 186 | Ga0072940_1278683 | 3300005200 | Unclassified | 1174 |
| 187 | Ga0466732_269704 | 3300042656 | Bacteria | 4569 |
| 188 | Ga0466702_054078 | 3300042635 | Bacteria | 1295 |
| 189 | Ga0466703_246030 | 3300042636 | Bacteria | 34589 |
| 190 | Ga0466704_596110 | 3300042643 | Unclassified | 6217 |
| 191 | Ga0456237_0000698 | 3300041968 | Bacteria | 5141 |
| 192 | Ga0466690_024431 | 3300042590 | Bacteria | 3384 |
| 193 | Ga0466691_048051 | 3300042593 | Bacteria | 6042 |
| 194 | Ga0466691_072140 | 3300042593 | Bacteria | 18727 |
| 195 | Ga0466696_245965 | 3300042596 | Bacteria | 17616 |
| 196 | Ga0466699_117882 | 3300042597 | Bacteria | 4532 |
| 197 | Ga0466699_226414 | 3300042597 | Bacteria | 1728 |
| 198 | Ga0466699_312309 | 3300042597 | Bacteria | 1733 |
| 199 | Ga0466715_139108 | 3300042616 | Bacteria | 3511 |
| 200 | Ga0466715_213789 | 3300042616 | Unclassified | 2127 |
| 201 | Ga0466723_028342 | 3300042618 | Bacteria | 6399 |
| 202 | Ga0466728_150093 | 3300042620 | Bacteria | 8526 |
| 203 | Ga0466728_170239 | 3300042620 | Bacteria | 7365 |
| 204 | JGI24695J34938_10000012 | 3300002450 | Bacteria | 126955 |
| 205 | JGI24695J34938_10008213 | 3300002450 | Bacteria | 5981 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF22091 | DUF6941 | Family of unknown function (DUF6941) | 28 | 149 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.