Protein Family IF00642

Metagenome Isolate
206 Members
102 Samples
146 Scaffolds
154.75 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10008013|JGI24695J34938_100080132
Length
178 aa
Sequence
MRFIPIFLNNDEGAISKAMKITIIAVGKIKEKFYRDALSEYDKRLSKYAKLKIIEVDDEKAPEHISDVLKEQILRKEGEKILRHITAGTYVVSLEIFGKSMDSEGFATHLSNLKVGGVSHIRFIIGGSLGLHPSVCERADMHLSFSAMTFPHQMMRVILLEQVYRAFRIEAGEPYHK*

📊 Sample Types

Isolate 29.1%
Metagenome 70.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.3%
Blattidae 22.2%
Termitidae 20.2%
Tenebrionidae 7.1%
Kalotermitidae 5.1%
Drosophilidae 4.0%
Rhinotermitidae 3.0%
Ixodidae 2.0%
Termopsidae 2.0%
Passalidae 2.0%
Hodotermitidae 1.0%
Scarabaeidae 1.0%
Apidae 1.0%
Syrphidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 52

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
2 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
3 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
4 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
5 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
6 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
7 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
8 2561511100 Mesoplasma photuris ATCC 49581 Isolate Unclassified
9 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
17 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
18 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
24 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
25 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
26 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
27 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
28 8112490586 Staphylococcus muscae CCM 4175 Isolate
29 2558860181 Spiroplasma mirum ATCC 29335 Isolate Ixodidae
30 2558860251 Spiroplasma mirum SMCA Isolate Ixodidae
31 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
32 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
33 2802429587 Spiroplasma eriocheiris CCTCC 'M 207170' Isolate Unclassified
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 8076013101 Spiroplasma poulsonii sHy/REF Isolate Drosophilidae
37 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
38 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
39 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
40 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
41 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
42 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
43 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
44 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 8012112996 Staphylococcus muscae ATCC 49910 Isolate
50 8067289520 Spiroplasma poulsonii MSRO_BK Isolate Drosophilidae
51 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
52 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
53 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
54 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
55 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
56 2545824514 Entomoplasma somnilux ATCC 49194 Isolate Unclassified
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
59 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
62 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
63 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
64 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
65 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
66 2820545146 Unclassified Firmicutes Lab288P1bin104 Isolate Unclassified
67 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
71 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
72 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
73 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
74 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
75 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
76 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
77 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
78 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
79 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
80 2806310699 Spiroplasma melliferum KC3 Isolate Unclassified
81 8100315503 Spiroplasma sp. hyd1 Isolate Drosophilidae
82 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
83 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
84 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
85 2554235371 Spiroplasma chrysopicola DF-1 Isolate Unclassified
86 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
87 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
88 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
89 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
90 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
91 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
92 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
93 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
94 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
95 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
96 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
97 2541047151 Spiroplasma melliferum IPMB4A Isolate Apidae
98 2554235381 Spiroplasma syrphidicola EA-1 Isolate Syrphidae
99 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
100 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
101 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
102 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_3382 3300056790 Unclassified 10657
2 Ga0562377_0382 3300056842 Unclassified 81248
3 Ga0562377_0600 3300056842 Unclassified 54769
4 Ga0562375_5626 3300056856 Unclassified 7142
5 Ga0562375_5746 3300056856 Unclassified 6781
6 Ga0562374_0280 3300057007 Unclassified 98840
7 Ga0466707_156011 3300042601 Bacteria 3851
8 Ga0123355_10617254 3300009826 Bacteria 1280
9 Ga0123356_10068174 3300010049 Bacteria 3332
10 Ga0123356_10480242 3300010049 Bacteria 1396
11 Ga0123356_11643523 3300010049 Bacteria 796
12 Ga0123353_10258342 3300010167 Bacteria 2693
13 Ga0123353_10764053 3300010167 Unclassified 1342
14 Ga0123354_10060745 3300010882 Bacteria 5586
15 Ga0466731_342100 3300042622 Bacteria 3607
16 Ga0466725_339726 3300042654 Bacteria 9005
17 Ga0466692_011278 3300042591 Bacteria 21280
18 Ga0466733_083879 3300042659 Bacteria 1933
19 Ga0466733_144102 3300042659 Bacteria 37735
20 Ga0466733_180287 3300042659 Bacteria 3475
21 Ga0466733_220803 3300042659 Bacteria 1714
22 Ga0562378_1678 3300056814 Unclassified 22607
23 Ga0562377_0935 3300056842 Unclassified 37245
24 Ga0562375_1903 3300056856 Unclassified 25597
25 Ga0562375_5181 3300056856 Unclassified 8412
26 Ga0562376_0914 3300056857 Unclassified 46177
27 Ga0562374_0323 3300057007 Unclassified 90179
28 Ga0466707_327366 3300042601 Bacteria 3292
29 Ga0466713_115509 3300042602 Bacteria 3862
30 IMNBL1DRAFT_c0000380 3300000062 Bacteria 37967
31 JGI24702J35022_10016186 3300002462 Unclassified 4091
32 Ga0123355_10048815 3300009826 Bacteria 6883
33 Ga0123355_10400727 3300009826 Bacteria 1770
34 Ga0123353_10460184 3300010167 Bacteria 1870
35 Ga0123353_10998341 3300010167 Bacteria 1125
36 Ga0466715_454892 3300042616 Bacteria 75769
37 Ga0466697_232862 3300042611 Bacteria 1371
38 Ga0466734_151366 3300042623 Bacteria 1066
39 Ga0466657_032428 3300042582 Unclassified 2420
40 Ga0562378_3294 3300056814 Bacteria 10232
41 Ga0562377_1832 3300056842 Unclassified 19169
42 Ga0562377_2526 3300056842 Unclassified 13315
43 Ga0562375_0530 3300056856 Unclassified 77134
44 Ga0562376_1869 3300056857 Unclassified 27543
45 Ga0466707_259060 3300042601 Bacteria 63426
46 Ga0466714_011982 3300042603 Bacteria 1596
47 2227498800 2225789004 Bacteria 3856
48 IMNBL1DRAFT_c0003742 3300000062 Bacteria 9529
49 IMNBL1DRAFT_c0103069 3300000062 Bacteria 765
50 AustNasuHG_c1002721 3300000089 Bacteria 6375
51 Ga0123355_10407015 3300009826 Bacteria 1750
52 Ga0123356_10281695 3300010049 Bacteria 1758
53 Ga0123353_10080939 3300010167 Bacteria 5222
54 Ga0123353_10372286 3300010167 Bacteria 2141
55 Ga0466729_119604 3300042621 Bacteria 18283
56 Ga0466734_091315 3300042623 Bacteria 1868
57 Ga0466704_329179 3300042643 Bacteria 3191
58 Ga0562379_5199 3300056790 Unclassified 4931
59 Ga0562377_0631 3300056842 Unclassified 53126
60 Ga0562377_0907 3300056842 Unclassified 38500
61 Ga0562377_1187 3300056842 Unclassified 30071
62 Ga0562375_1218 3300056856 Unclassified 37177
63 Ga0562375_5360 3300056856 Unclassified 7864
64 Ga0562375_6241 3300056856 Unclassified 5372
65 Ga0562376_0834 3300056857 Unclassified 49351
66 Ga0562376_4957 3300056857 Unclassified 9764
67 Ga0466700_146444 3300042600 Unclassified 2441
68 Ga0466707_064987 3300042601 Bacteria 29074
69 Ga0466707_296781 3300042601 Bacteria 32330
70 Ga0466713_147492 3300042602 Bacteria 11536
71 Ga0123355_10540731 3300009826 Bacteria 1414
72 Ga0123353_10114614 3300010167 Bacteria 4339
73 Ga0123353_10125157 3300010167 Bacteria 4131
74 Ga0123354_10162691 3300010882 Bacteria 2640
75 Ga0466726_484872 3300042619 Bacteria 8527
76 Ga0466703_068854 3300042636 Bacteria 8990
77 Ga0562379_0003 3300056790 Bacteria 3011780
78 Ga0562377_0006 3300056842 Bacteria 3350072
79 Ga0562377_0460 3300056842 Unclassified 68204
80 Ga0562376_1968 3300056857 Unclassified 26677
81 Ga0562376_2402 3300056857 Unclassified 22325
82 Ga0562376_5308 3300056857 Unclassified 8663
83 Ga0562376_6442 3300056857 Unclassified 4683
84 Ga0562374_0401 3300057007 Bacteria 77777
85 Ga0466706_246551 3300042599 Bacteria 1113
86 Ga0466700_168972 3300042600 Bacteria 1096
87 Ga0466719_336472 3300042606 Bacteria 54006
88 Ga0466722_082143 3300042609 Bacteria 3265
89 Ga0466698_074981 3300042610 Unclassified 1031
90 2227505169 2225789004 Bacteria 19039
91 Ga0123355_10104429 3300009826 Bacteria 4450
92 Ga0123353_10000030 3300010167 Bacteria 161205
93 Ga0123353_10040418 3300010167 Bacteria 7358
94 Ga0466733_007962 3300042659 Bacteria 9232
95 Ga0466733_119497 3300042659 Bacteria 1201
96 Ga0466733_155091 3300042659 Bacteria 1686
97 Ga0562379_3380 3300056790 Unclassified 10660
98 Ga0562378_1059 3300056814 Unclassified 33934
99 Ga0562378_1273 3300056814 Bacteria 28768
100 Ga0562375_3754 3300056856 Unclassified 13335
101 Ga0562375_5575 3300056856 Unclassified 7276
102 Ga0562376_0442 3300056857 Unclassified 77810
103 Ga0562376_1457 3300056857 Unclassified 33248
104 Ga0562376_4845 3300056857 Unclassified 10168
105 Ga0466700_302328 3300042600 Bacteria 3065
106 Ga0466700_310008 3300042600 Bacteria 1157
107 Ga0466707_178521 3300042601 Bacteria 5413
108 Ga0466707_253337 3300042601 Bacteria 1059
109 Ga0068305_10001588 3300005083 Bacteria 82211
110 Ga0123356_11457833 3300010049 Bacteria 843
111 Ga0123353_10537804 3300010167 Bacteria 1689
112 Ga0466730_086362 3300042625 Bacteria 3070
113 Ga0466703_094377 3300042636 Bacteria 2085
114 Ga0466704_368402 3300042643 Bacteria 8441
115 Ga0562378_0666 3300056814 Unclassified 51271
116 Ga0562377_0263 3300056842 Unclassified 116907
117 Ga0562375_3492 3300056856 Unclassified 14576
118 Ga0562376_0009 3300056857 Bacteria 1013235
119 Ga0562376_1763 3300056857 Bacteria 28889
120 Ga0562376_3176 3300056857 Unclassified 17303
121 Ga0466706_125760 3300042599 Bacteria 2837
122 Ga0466707_143872 3300042601 Bacteria 3568
123 Ga0466707_286647 3300042601 Unclassified 8770
124 Ga0466722_133138 3300042609 Bacteria 2064
125 JGI24700J35501_10930663 3300002508 Bacteria 18219
126 Ga0068302_10244105 3300005071 Unclassified 595
127 Ga0123355_10170289 3300009826 Bacteria 3257
128 Ga0123356_10092920 3300010049 Bacteria 2878
129 Ga0123354_10086066 3300010882 Bacteria 4397
130 Ga0466697_062265 3300042611 Bacteria 2648
131 Ga0466729_286836 3300042621 Bacteria 3235
132 Ga0466734_033236 3300042623 Bacteria 1883
133 Ga0466709_279759 3300042648 Bacteria 128062
134 Ga0466693_382275 3300042592 Bacteria 2010
135 Ga0466699_084384 3300042597 Bacteria 1009
136 Ga0562377_0610 3300056842 Unclassified 54256
137 Ga0562377_2636 3300056842 Bacteria 12658
138 Ga0562375_3074 3300056856 Unclassified 16661
139 Ga0562376_2196 3300056857 Unclassified 24363
140 Ga0466722_034072 3300042609 Bacteria 33241
141 IMNBL1DRAFT_c0004254 3300000062 Bacteria 8674
142 IMNBL1DRAFT_c0022900 3300000062 Bacteria 2459
143 JGI24695J34938_10008013 3300002450 Bacteria 6091
144 JGI24702J35022_10022394 3300002462 Bacteria 3419
145 Ga0123353_10003995 3300010167 Bacteria 18876
146 Ga0123353_10006504 3300010167 Unclassified 15566

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02590 SPOUT_MTase Predicted SPOUT methyltransferase 19 176 0.96
PF23400 14 97 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.