Protein Family IF00627

Metagenome Metatranscriptome Isolate
177 Members
51 Samples
159 Scaffolds
210.58 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10004355|JGI24695J34938_100043554
Length
255 aa
Sequence
MPEGVHGIFPVLYQVPIMKINMFRTNQSGIPSVNRINIKNSWLDILFRFIPVRTGSCLIIILISGFHALAADTFTFRADRMSGSRALGRETTILVGNAEVRSDNLLLRADRIEISGDDNQFIECIGNVWGHEEDKNILFYTDRLRYDRTLKIARLEGNSSLEDRENEIVARARFIEYDDENEITVMQISVRLFKDDMVCRSEHAIYYRGEKILDLSGFPVVYKKEDEFRADKIRVDIETDDVIMEGSVSGTIIN*

πŸ“Š Sample Types

Isolate 10.2%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 1.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 46.9%
Unclassified 36.7%
Kalotermitidae 14.3%
Termopsidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
2 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
3 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
4 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
5 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
6 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
7 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
8 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
9 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
10 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
11 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
12 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
33 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
34 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
35 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
36 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
37 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
43 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
44 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
51 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_292514 3300042612 Bacteria 1997
2 JGI24698J34947_10022798 3300002449 Bacteria 3353
3 JGI24698J34947_10038408 3300002449 Bacteria 2484
4 JGI24698J34947_10054090 3300002449 Bacteria 2006
5 JGI24695J34938_10000061 3300002450 Bacteria 88663
6 Ga0072941_1054844 3300005201 Bacteria 1641
7 Ga0466709_074685 3300042648 Unclassified 1422
8 Ga0466700_024443 3300042600 Bacteria 1947
9 Ga0123356_10010200 3300010049 Bacteria 9238
10 Ga0123356_10030369 3300010049 Bacteria 5059
11 Ga0123356_10055755 3300010049 Bacteria 3681
12 Ga0123356_10911189 3300010049 Bacteria 1050
13 Ga0466693_173388 3300042592 Bacteria 4962
14 Ga0466694_108320 3300042594 Bacteria 1253
15 Ga0466699_045355 3300042597 Unclassified 1771
16 JGI24695J34938_10000339 3300002450 Bacteria 46161
17 JGI24695J34938_10002464 3300002450 Bacteria 14131
18 JGI24695J34938_10005953 3300002450 Bacteria 7463
19 JGI24695J34938_10016858 3300002450 Bacteria 3701
20 JGI24695J34938_10094202 3300002450 Bacteria 1227
21 JGI24696J40584_12928312 3300002834 Bacteria 1438
22 Ga0466712_116307 3300042614 Bacteria 1151
23 Ga0466712_211856 3300042614 Bacteria 6230
24 Ga0466731_268624 3300042622 Bacteria 7536
25 Ga0466704_000209 3300042643 Bacteria 8784
26 Ga0466708_005994 3300042652 Bacteria 7936
27 Ga0123355_10115267 3300009826 Bacteria 4185
28 Ga0123356_10003413 3300010049 Bacteria 16659
29 Ga0123356_10004124 3300010049 Bacteria 15095
30 Ga0123356_10034723 3300010049 Bacteria 4713
31 Ga0123356_10057509 3300010049 Unclassified 3625
32 Ga0123356_10659926 3300010049 Bacteria 1213
33 Ga0264413_132023 3300024493 Bacteria 2180
34 JGI24698J34947_10027975 3300002449 Unclassified 2989
35 JGI24698J34947_10035039 3300002449 Bacteria 2623
36 JGI24698J34947_10061700 3300002449 Unclassified 1844
37 JGI24695J34938_10001795 3300002450 Bacteria 17641
38 JGI24695J34938_10003343 3300002450 Bacteria 11288
39 JGI24695J34938_10013319 3300002450 Bacteria 4324
40 JGI24695J34938_10016348 3300002450 Unclassified 3775
41 JGI24697J35500_11261828 3300002507 Unclassified 3080
42 Ga0072941_1003904 3300005201 Bacteria 42341
43 Ga0072941_1006132 3300005201 Bacteria 3554
44 Ga0072941_1006133 3300005201 Bacteria 3985
45 Ga0074263_116008 3300005485 Bacteria 1874
46 Ga0466712_197482 3300042614 Bacteria 30868
47 Ga0466726_211510 3300042619 Bacteria 2192
48 Ga0466731_270503 3300042622 Bacteria 27160
49 Ga0466702_142582 3300042635 Bacteria 3489
50 Ga0466707_364424 3300042601 Bacteria 1431
51 Ga0466720_170034 3300042607 Bacteria 1717
52 Ga0123356_10000034 3300010049 Bacteria 149865
53 Ga0123356_11296963 3300010049 Bacteria 891
54 Ga0264413_107958 3300024493 Bacteria 5572
55 Ga0415639_023508 3300038395 Bacteria 2768
56 Ga0466694_007900 3300042594 Bacteria 4543
57 Ga0466694_012070 3300042594 Bacteria 2300
58 Ga0466694_103245 3300042594 Bacteria 5830
59 JGI24698J34947_10001226 3300002449 Bacteria 13415
60 JGI24698J34947_10038048 3300002449 Bacteria 2497
61 JGI24698J34947_10069308 3300002449 Unclassified 1702
62 JGI24695J34938_10000422 3300002450 Bacteria 41047
63 JGI24695J34938_10001237 3300002450 Bacteria 22513
64 JGI24697J35500_11268727 3300002507 Bacteria 3854
65 Ga0072941_1022274 3300005201 Bacteria 3182
66 Ga0466702_061392 3300042635 Bacteria 2066
67 Ga0466702_123057 3300042635 Bacteria 1499
68 Ga0466709_075266 3300042648 Bacteria 1404
69 Ga0466709_150373 3300042648 Bacteria 8622
70 Ga0466698_227237 3300042610 Bacteria 1603
71 Ga0123355_10164983 3300009826 Bacteria 3327
72 Ga0123356_10003448 3300010049 Bacteria 16546
73 Ga0123356_10008576 3300010049 Bacteria 10145
74 Ga0123356_10096841 3300010049 Bacteria 2822
75 Ga0123353_10126830 3300010167 Bacteria 4101
76 Ga0466699_017614 3300042597 Bacteria 28515
77 Ga0466705_262573 3300042612 Bacteria 22211
78 AustNasuHG_c1021999 3300000089 Unclassified 2055
79 JGI24698J34947_10052417 3300002449 Bacteria 2047
80 JGI24695J34938_10002451 3300002450 Bacteria 14179
81 JGI24695J34938_10003036 3300002450 Bacteria 12042
82 JGI24695J34938_10004355 3300002450 Bacteria 9322
83 JGI24695J34938_10006139 3300002450 Bacteria 7311
84 JGI24695J34938_10009423 3300002450 Bacteria 5428
85 JGI24695J34938_10017520 3300002450 Bacteria 3606
86 Ga0072941_1006131 3300005201 Bacteria 2715
87 Ga0072941_1019977 3300005201 Bacteria 4985
88 Ga0072941_1019978 3300005201 Bacteria 1653
89 Ga0466718_121425 3300042617 Bacteria 1879
90 Ga0466702_199323 3300042635 Bacteria 2588
91 Ga0466703_048752 3300042636 Bacteria 7406
92 Ga0466704_592240 3300042643 Bacteria 1300
93 Ga0123356_10008382 3300010049 Bacteria 10279
94 Ga0123356_10324389 3300010049 Bacteria 1654
95 Ga0123356_11297531 3300010049 Bacteria 891
96 Ga0466696_012885 3300042596 Bacteria 1019
97 Ga0466696_045725 3300042596 Bacteria 4501
98 AustNasuHG_c1020584 3300000089 Bacteria 2147
99 JGI24698J34947_10010466 3300002449 Bacteria 5089
100 JGI24698J34947_10026007 3300002449 Bacteria 3112
101 JGI24695J34938_10012073 3300002450 Bacteria 4605
102 JGI24695J34938_10044070 3300002450 Bacteria 1986
103 JGI24695J34938_10060932 3300002450 Bacteria 1608
104 JGI24695J34938_10161305 3300002450 Bacteria 921
105 Ga0466712_022129 3300042614 Bacteria 6904
106 Ga0466712_118253 3300042614 Bacteria 1132
107 Ga0466718_000928 3300042617 Bacteria 2707
108 Ga0466718_046971 3300042617 Bacteria 6752
109 Ga0466702_462182 3300042635 Bacteria 3112
110 Ga0123353_10010839 3300010167 Bacteria 12762
111 Ga0415639_023507 3300038395 Bacteria 3592
112 Ga0415639_045212 3300038395 Bacteria 9361
113 Ga0415639_077883 3300038395 Bacteria 1670
114 Ga0466693_026753 3300042592 Bacteria 30398
115 Ga0466694_013736 3300042594 Bacteria 7463
116 Ga0466699_329300 3300042597 Bacteria 4403
117 AustNasuHG_c1003481 3300000089 Bacteria 5685
118 JGI24698J34947_10011940 3300002449 Bacteria 4769
119 JGI24698J34947_10013506 3300002449 Unclassified 4457
120 JGI24695J34938_10005117 3300002450 Bacteria 8314
121 JGI24695J34938_10006141 3300002450 Bacteria 7310
122 JGI24695J34938_10022032 3300002450 Bacteria 3103
123 JGI24695J34938_10056515 3300002450 Bacteria 1691
124 JGI24695J34938_10163690 3300002450 Bacteria 915
125 Ga0072941_1002508 3300005201 Bacteria 44197
126 Ga0072941_1038272 3300005201 Bacteria 8246
127 Ga0072941_1048721 3300005201 Bacteria 7370
128 Ga0466712_106240 3300042614 Bacteria 18842
129 Ga0466728_467960 3300042620 Bacteria 1908
130 Ga0466702_260569 3300042635 Bacteria 1241
131 Ga0466702_464068 3300042635 Bacteria 1997
132 Ga0466717_150349 3300042604 Bacteria 1093
133 Ga0123355_10867271 3300009826 Bacteria 989
134 Ga0123356_10336705 3300010049 Bacteria 1628
135 Ga0123356_10476320 3300010049 Unclassified 1401
136 Ga0123356_10556831 3300010049 Bacteria 1308
137 Ga0223687_130830 3300021217 Bacteria 997
138 Ga0255786_1029035 3300022815 Bacteria 2003
139 Ga0466694_099577 3300042594 Bacteria 97987
140 Ga0466705_024222 3300042612 Bacteria 6294
141 JGI24695J34938_10010212 3300002450 Bacteria 5165
142 JGI24695J34938_10030065 3300002450 Bacteria 2534
143 JGI24695J34938_10068051 3300002450 Bacteria 1497
144 JGI24695J34938_10080244 3300002450 Bacteria 1349
145 Ga0072941_1211883 3300005201 Unclassified 1263
146 Ga0466712_050273 3300042614 Bacteria 13620
147 Ga0466712_098208 3300042614 Bacteria 20522
148 Ga0466712_158799 3300042614 Bacteria 33609
149 Ga0466712_299217 3300042614 Bacteria 9112
150 Ga0466731_147523 3300042622 Bacteria 1385
151 Ga0466731_250304 3300042622 Bacteria 1693
152 Ga0466702_023079 3300042635 Bacteria 1259
153 Ga0466702_042892 3300042635 Bacteria 2414
154 Ga0466708_063054 3300042652 Bacteria 3310
155 Ga0123356_10000120 3300010049 Bacteria 85763
156 Ga0123356_10001167 3300010049 Bacteria 29047
157 Ga0123356_10068701 3300010049 Bacteria 3320
158 Ga0123356_10236965 3300010049 Bacteria 1893
159 Ga0264413_133161 3300024493 Bacteria 1495

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13100 OstA_2 OstA-like protein 77 206 0.86
PF03968 LptD_N LptA/(LptD N-terminal domain) LPS transport protein 90 194 0.79

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.