Protein Family IF00627
Metagenome
Metatranscriptome
Isolate
177
Members
51
Samples
159
Scaffolds
210.58
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10004355|JGI24695J34938_100043554
- Length
- 255 aa
- Sequence
- MPEGVHGIFPVLYQVPIMKINMFRTNQSGIPSVNRINIKNSWLDILFRFIPVRTGSCLIIILISGFHALAADTFTFRADRMSGSRALGRETTILVGNAEVRSDNLLLRADRIEISGDDNQFIECIGNVWGHEEDKNILFYTDRLRYDRTLKIARLEGNSSLEDRENEIVARARFIEYDDENEITVMQISVRLFKDDMVCRSEHAIYYRGEKILDLSGFPVVYKKEDEFRADKIRVDIETDDVIMEGSVSGTIIN*
Sample Types
Isolate
10.2%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.9%
Unclassified
36.7%
Kalotermitidae
14.3%
Termopsidae
2.0%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 2 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 3 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 4 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 5 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 6 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 7 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 8 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 9 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 10 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 11 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 12 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 33 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 34 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 35 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 36 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 37 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 43 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 44 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 51 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_292514 | 3300042612 | Bacteria | 1997 |
| 2 | JGI24698J34947_10022798 | 3300002449 | Bacteria | 3353 |
| 3 | JGI24698J34947_10038408 | 3300002449 | Bacteria | 2484 |
| 4 | JGI24698J34947_10054090 | 3300002449 | Bacteria | 2006 |
| 5 | JGI24695J34938_10000061 | 3300002450 | Bacteria | 88663 |
| 6 | Ga0072941_1054844 | 3300005201 | Bacteria | 1641 |
| 7 | Ga0466709_074685 | 3300042648 | Unclassified | 1422 |
| 8 | Ga0466700_024443 | 3300042600 | Bacteria | 1947 |
| 9 | Ga0123356_10010200 | 3300010049 | Bacteria | 9238 |
| 10 | Ga0123356_10030369 | 3300010049 | Bacteria | 5059 |
| 11 | Ga0123356_10055755 | 3300010049 | Bacteria | 3681 |
| 12 | Ga0123356_10911189 | 3300010049 | Bacteria | 1050 |
| 13 | Ga0466693_173388 | 3300042592 | Bacteria | 4962 |
| 14 | Ga0466694_108320 | 3300042594 | Bacteria | 1253 |
| 15 | Ga0466699_045355 | 3300042597 | Unclassified | 1771 |
| 16 | JGI24695J34938_10000339 | 3300002450 | Bacteria | 46161 |
| 17 | JGI24695J34938_10002464 | 3300002450 | Bacteria | 14131 |
| 18 | JGI24695J34938_10005953 | 3300002450 | Bacteria | 7463 |
| 19 | JGI24695J34938_10016858 | 3300002450 | Bacteria | 3701 |
| 20 | JGI24695J34938_10094202 | 3300002450 | Bacteria | 1227 |
| 21 | JGI24696J40584_12928312 | 3300002834 | Bacteria | 1438 |
| 22 | Ga0466712_116307 | 3300042614 | Bacteria | 1151 |
| 23 | Ga0466712_211856 | 3300042614 | Bacteria | 6230 |
| 24 | Ga0466731_268624 | 3300042622 | Bacteria | 7536 |
| 25 | Ga0466704_000209 | 3300042643 | Bacteria | 8784 |
| 26 | Ga0466708_005994 | 3300042652 | Bacteria | 7936 |
| 27 | Ga0123355_10115267 | 3300009826 | Bacteria | 4185 |
| 28 | Ga0123356_10003413 | 3300010049 | Bacteria | 16659 |
| 29 | Ga0123356_10004124 | 3300010049 | Bacteria | 15095 |
| 30 | Ga0123356_10034723 | 3300010049 | Bacteria | 4713 |
| 31 | Ga0123356_10057509 | 3300010049 | Unclassified | 3625 |
| 32 | Ga0123356_10659926 | 3300010049 | Bacteria | 1213 |
| 33 | Ga0264413_132023 | 3300024493 | Bacteria | 2180 |
| 34 | JGI24698J34947_10027975 | 3300002449 | Unclassified | 2989 |
| 35 | JGI24698J34947_10035039 | 3300002449 | Bacteria | 2623 |
| 36 | JGI24698J34947_10061700 | 3300002449 | Unclassified | 1844 |
| 37 | JGI24695J34938_10001795 | 3300002450 | Bacteria | 17641 |
| 38 | JGI24695J34938_10003343 | 3300002450 | Bacteria | 11288 |
| 39 | JGI24695J34938_10013319 | 3300002450 | Bacteria | 4324 |
| 40 | JGI24695J34938_10016348 | 3300002450 | Unclassified | 3775 |
| 41 | JGI24697J35500_11261828 | 3300002507 | Unclassified | 3080 |
| 42 | Ga0072941_1003904 | 3300005201 | Bacteria | 42341 |
| 43 | Ga0072941_1006132 | 3300005201 | Bacteria | 3554 |
| 44 | Ga0072941_1006133 | 3300005201 | Bacteria | 3985 |
| 45 | Ga0074263_116008 | 3300005485 | Bacteria | 1874 |
| 46 | Ga0466712_197482 | 3300042614 | Bacteria | 30868 |
| 47 | Ga0466726_211510 | 3300042619 | Bacteria | 2192 |
| 48 | Ga0466731_270503 | 3300042622 | Bacteria | 27160 |
| 49 | Ga0466702_142582 | 3300042635 | Bacteria | 3489 |
| 50 | Ga0466707_364424 | 3300042601 | Bacteria | 1431 |
| 51 | Ga0466720_170034 | 3300042607 | Bacteria | 1717 |
| 52 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 53 | Ga0123356_11296963 | 3300010049 | Bacteria | 891 |
| 54 | Ga0264413_107958 | 3300024493 | Bacteria | 5572 |
| 55 | Ga0415639_023508 | 3300038395 | Bacteria | 2768 |
| 56 | Ga0466694_007900 | 3300042594 | Bacteria | 4543 |
| 57 | Ga0466694_012070 | 3300042594 | Bacteria | 2300 |
| 58 | Ga0466694_103245 | 3300042594 | Bacteria | 5830 |
| 59 | JGI24698J34947_10001226 | 3300002449 | Bacteria | 13415 |
| 60 | JGI24698J34947_10038048 | 3300002449 | Bacteria | 2497 |
| 61 | JGI24698J34947_10069308 | 3300002449 | Unclassified | 1702 |
| 62 | JGI24695J34938_10000422 | 3300002450 | Bacteria | 41047 |
| 63 | JGI24695J34938_10001237 | 3300002450 | Bacteria | 22513 |
| 64 | JGI24697J35500_11268727 | 3300002507 | Bacteria | 3854 |
| 65 | Ga0072941_1022274 | 3300005201 | Bacteria | 3182 |
| 66 | Ga0466702_061392 | 3300042635 | Bacteria | 2066 |
| 67 | Ga0466702_123057 | 3300042635 | Bacteria | 1499 |
| 68 | Ga0466709_075266 | 3300042648 | Bacteria | 1404 |
| 69 | Ga0466709_150373 | 3300042648 | Bacteria | 8622 |
| 70 | Ga0466698_227237 | 3300042610 | Bacteria | 1603 |
| 71 | Ga0123355_10164983 | 3300009826 | Bacteria | 3327 |
| 72 | Ga0123356_10003448 | 3300010049 | Bacteria | 16546 |
| 73 | Ga0123356_10008576 | 3300010049 | Bacteria | 10145 |
| 74 | Ga0123356_10096841 | 3300010049 | Bacteria | 2822 |
| 75 | Ga0123353_10126830 | 3300010167 | Bacteria | 4101 |
| 76 | Ga0466699_017614 | 3300042597 | Bacteria | 28515 |
| 77 | Ga0466705_262573 | 3300042612 | Bacteria | 22211 |
| 78 | AustNasuHG_c1021999 | 3300000089 | Unclassified | 2055 |
| 79 | JGI24698J34947_10052417 | 3300002449 | Bacteria | 2047 |
| 80 | JGI24695J34938_10002451 | 3300002450 | Bacteria | 14179 |
| 81 | JGI24695J34938_10003036 | 3300002450 | Bacteria | 12042 |
| 82 | JGI24695J34938_10004355 | 3300002450 | Bacteria | 9322 |
| 83 | JGI24695J34938_10006139 | 3300002450 | Bacteria | 7311 |
| 84 | JGI24695J34938_10009423 | 3300002450 | Bacteria | 5428 |
| 85 | JGI24695J34938_10017520 | 3300002450 | Bacteria | 3606 |
| 86 | Ga0072941_1006131 | 3300005201 | Bacteria | 2715 |
| 87 | Ga0072941_1019977 | 3300005201 | Bacteria | 4985 |
| 88 | Ga0072941_1019978 | 3300005201 | Bacteria | 1653 |
| 89 | Ga0466718_121425 | 3300042617 | Bacteria | 1879 |
| 90 | Ga0466702_199323 | 3300042635 | Bacteria | 2588 |
| 91 | Ga0466703_048752 | 3300042636 | Bacteria | 7406 |
| 92 | Ga0466704_592240 | 3300042643 | Bacteria | 1300 |
| 93 | Ga0123356_10008382 | 3300010049 | Bacteria | 10279 |
| 94 | Ga0123356_10324389 | 3300010049 | Bacteria | 1654 |
| 95 | Ga0123356_11297531 | 3300010049 | Bacteria | 891 |
| 96 | Ga0466696_012885 | 3300042596 | Bacteria | 1019 |
| 97 | Ga0466696_045725 | 3300042596 | Bacteria | 4501 |
| 98 | AustNasuHG_c1020584 | 3300000089 | Bacteria | 2147 |
| 99 | JGI24698J34947_10010466 | 3300002449 | Bacteria | 5089 |
| 100 | JGI24698J34947_10026007 | 3300002449 | Bacteria | 3112 |
| 101 | JGI24695J34938_10012073 | 3300002450 | Bacteria | 4605 |
| 102 | JGI24695J34938_10044070 | 3300002450 | Bacteria | 1986 |
| 103 | JGI24695J34938_10060932 | 3300002450 | Bacteria | 1608 |
| 104 | JGI24695J34938_10161305 | 3300002450 | Bacteria | 921 |
| 105 | Ga0466712_022129 | 3300042614 | Bacteria | 6904 |
| 106 | Ga0466712_118253 | 3300042614 | Bacteria | 1132 |
| 107 | Ga0466718_000928 | 3300042617 | Bacteria | 2707 |
| 108 | Ga0466718_046971 | 3300042617 | Bacteria | 6752 |
| 109 | Ga0466702_462182 | 3300042635 | Bacteria | 3112 |
| 110 | Ga0123353_10010839 | 3300010167 | Bacteria | 12762 |
| 111 | Ga0415639_023507 | 3300038395 | Bacteria | 3592 |
| 112 | Ga0415639_045212 | 3300038395 | Bacteria | 9361 |
| 113 | Ga0415639_077883 | 3300038395 | Bacteria | 1670 |
| 114 | Ga0466693_026753 | 3300042592 | Bacteria | 30398 |
| 115 | Ga0466694_013736 | 3300042594 | Bacteria | 7463 |
| 116 | Ga0466699_329300 | 3300042597 | Bacteria | 4403 |
| 117 | AustNasuHG_c1003481 | 3300000089 | Bacteria | 5685 |
| 118 | JGI24698J34947_10011940 | 3300002449 | Bacteria | 4769 |
| 119 | JGI24698J34947_10013506 | 3300002449 | Unclassified | 4457 |
| 120 | JGI24695J34938_10005117 | 3300002450 | Bacteria | 8314 |
| 121 | JGI24695J34938_10006141 | 3300002450 | Bacteria | 7310 |
| 122 | JGI24695J34938_10022032 | 3300002450 | Bacteria | 3103 |
| 123 | JGI24695J34938_10056515 | 3300002450 | Bacteria | 1691 |
| 124 | JGI24695J34938_10163690 | 3300002450 | Bacteria | 915 |
| 125 | Ga0072941_1002508 | 3300005201 | Bacteria | 44197 |
| 126 | Ga0072941_1038272 | 3300005201 | Bacteria | 8246 |
| 127 | Ga0072941_1048721 | 3300005201 | Bacteria | 7370 |
| 128 | Ga0466712_106240 | 3300042614 | Bacteria | 18842 |
| 129 | Ga0466728_467960 | 3300042620 | Bacteria | 1908 |
| 130 | Ga0466702_260569 | 3300042635 | Bacteria | 1241 |
| 131 | Ga0466702_464068 | 3300042635 | Bacteria | 1997 |
| 132 | Ga0466717_150349 | 3300042604 | Bacteria | 1093 |
| 133 | Ga0123355_10867271 | 3300009826 | Bacteria | 989 |
| 134 | Ga0123356_10336705 | 3300010049 | Bacteria | 1628 |
| 135 | Ga0123356_10476320 | 3300010049 | Unclassified | 1401 |
| 136 | Ga0123356_10556831 | 3300010049 | Bacteria | 1308 |
| 137 | Ga0223687_130830 | 3300021217 | Bacteria | 997 |
| 138 | Ga0255786_1029035 | 3300022815 | Bacteria | 2003 |
| 139 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
| 140 | Ga0466705_024222 | 3300042612 | Bacteria | 6294 |
| 141 | JGI24695J34938_10010212 | 3300002450 | Bacteria | 5165 |
| 142 | JGI24695J34938_10030065 | 3300002450 | Bacteria | 2534 |
| 143 | JGI24695J34938_10068051 | 3300002450 | Bacteria | 1497 |
| 144 | JGI24695J34938_10080244 | 3300002450 | Bacteria | 1349 |
| 145 | Ga0072941_1211883 | 3300005201 | Unclassified | 1263 |
| 146 | Ga0466712_050273 | 3300042614 | Bacteria | 13620 |
| 147 | Ga0466712_098208 | 3300042614 | Bacteria | 20522 |
| 148 | Ga0466712_158799 | 3300042614 | Bacteria | 33609 |
| 149 | Ga0466712_299217 | 3300042614 | Bacteria | 9112 |
| 150 | Ga0466731_147523 | 3300042622 | Bacteria | 1385 |
| 151 | Ga0466731_250304 | 3300042622 | Bacteria | 1693 |
| 152 | Ga0466702_023079 | 3300042635 | Bacteria | 1259 |
| 153 | Ga0466702_042892 | 3300042635 | Bacteria | 2414 |
| 154 | Ga0466708_063054 | 3300042652 | Bacteria | 3310 |
| 155 | Ga0123356_10000120 | 3300010049 | Bacteria | 85763 |
| 156 | Ga0123356_10001167 | 3300010049 | Bacteria | 29047 |
| 157 | Ga0123356_10068701 | 3300010049 | Bacteria | 3320 |
| 158 | Ga0123356_10236965 | 3300010049 | Bacteria | 1893 |
| 159 | Ga0264413_133161 | 3300024493 | Bacteria | 1495 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.