Protein Family IF00575
Metagenome
Metatranscriptome
Isolate
182
Members
56
Samples
171
Scaffolds
106.97
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10320611|JGI24698J34947_103206112
- Length
- 126 aa
- Sequence
- MRSLTKRQRRDLMAIQPIDLQTLFTQMDKVAKTQNAQREGLALHQTIQGVQIQRKTEEHIQSVNEAQNTGDDGTDKIKDRPSSRGGKESGEGKKKETREGASEQDEAQDPVISDPRLGKNIDISL*
Sample Types
Isolate
6.0%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.7%
Kalotermitidae
25.9%
Unclassified
20.4%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Blaberidae
1.9%
Taxonomy
Archaea
2
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 8 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 9 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 10 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 33 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 34 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 40 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 41 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 46 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 47 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 48 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 49 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 50 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_116961 | 3300042591 | Bacteria | 2114 |
| 2 | Ga0466691_027436 | 3300042593 | Bacteria | 2645 |
| 3 | Ga0466694_331606 | 3300042594 | Bacteria | 1820 |
| 4 | Ga0466696_044906 | 3300042596 | Bacteria | 17287 |
| 5 | Ga0466699_076896 | 3300042597 | Bacteria | 5226 |
| 6 | Ga0466699_326430 | 3300042597 | Bacteria | 1873 |
| 7 | Ga0466712_093077 | 3300042614 | Unclassified | 12127 |
| 8 | Ga0466712_135099 | 3300042614 | Bacteria | 31734 |
| 9 | Ga0466712_224965 | 3300042614 | Bacteria | 1974 |
| 10 | Ga0466711_126349 | 3300042615 | Bacteria | 8885 |
| 11 | Ga0466711_153056 | 3300042615 | Bacteria | 2887 |
| 12 | Ga0466711_192365 | 3300042615 | Bacteria | 5615 |
| 13 | Ga0466718_040383 | 3300042617 | Bacteria | 1126 |
| 14 | Ga0466718_128893 | 3300042617 | Bacteria | 1378 |
| 15 | Ga0466728_313736 | 3300042620 | Bacteria | 1265 |
| 16 | Ga0466735_002007 | 3300042624 | Bacteria | 2985 |
| 17 | Ga0466704_418992 | 3300042643 | Unclassified | 5220 |
| 18 | Ga0466704_536030 | 3300042643 | Bacteria | 5952 |
| 19 | Ga0466708_123952 | 3300042652 | Bacteria | 4396 |
| 20 | Ga0466708_124310 | 3300042652 | Bacteria | 2526 |
| 21 | Ga0466708_390425 | 3300042652 | Bacteria | 1108 |
| 22 | Ga0466727_115106 | 3300042655 | Bacteria | 4503 |
| 23 | Ga0466727_341826 | 3300042655 | Bacteria | 3071 |
| 24 | Ga0123355_11939615 | 3300009826 | Bacteria | 549 |
| 25 | Ga0466705_047420 | 3300042612 | Bacteria | 1864 |
| 26 | Ga0466732_367713 | 3300042656 | Bacteria | 14986 |
| 27 | Ga0466691_171543 | 3300042593 | Bacteria | 6898 |
| 28 | Ga0466696_289208 | 3300042596 | Bacteria | 1992 |
| 29 | Ga0466711_096963 | 3300042615 | Bacteria | 1385 |
| 30 | Ga0466711_099063 | 3300042615 | Bacteria | 4136 |
| 31 | Ga0466728_443490 | 3300042620 | Bacteria | 2876 |
| 32 | Ga0466735_203190 | 3300042624 | Bacteria | 2106 |
| 33 | Ga0466708_301954 | 3300042652 | Bacteria | 10950 |
| 34 | Ga0123356_13873330 | 3300010049 | Bacteria | 516 |
| 35 | JGI24698J34947_10007374 | 3300002449 | Bacteria | 6046 |
| 36 | JGI24698J34947_10011904 | 3300002449 | Bacteria | 4777 |
| 37 | JGI24698J34947_10195026 | 3300002449 | Unclassified | 798 |
| 38 | Ga0466705_035658 | 3300042612 | Bacteria | 8758 |
| 39 | Ga0466705_377473 | 3300042612 | Bacteria | 16281 |
| 40 | Ga0466690_120758 | 3300042590 | Unclassified | 1277 |
| 41 | Ga0466691_012828 | 3300042593 | Bacteria | 16867 |
| 42 | Ga0466691_063358 | 3300042593 | Bacteria | 23082 |
| 43 | Ga0466696_105420 | 3300042596 | Bacteria | 5702 |
| 44 | Ga0466699_078873 | 3300042597 | Bacteria | 22366 |
| 45 | Ga0466705_525731 | 3300042612 | Bacteria | 8810 |
| 46 | Ga0466712_049674 | 3300042614 | Bacteria | 4144 |
| 47 | Ga0466715_121096 | 3300042616 | Bacteria | 1382 |
| 48 | Ga0466723_230369 | 3300042618 | Bacteria | 18065 |
| 49 | Ga0466723_298654 | 3300042618 | Bacteria | 6705 |
| 50 | Ga0466726_110234 | 3300042619 | Bacteria | 1052 |
| 51 | Ga0466726_463378 | 3300042619 | Unclassified | 1139 |
| 52 | Ga0466728_125604 | 3300042620 | Bacteria | 4218 |
| 53 | Ga0466728_171676 | 3300042620 | Bacteria | 4324 |
| 54 | Ga0466728_290085 | 3300042620 | Bacteria | 3259 |
| 55 | Ga0466728_384635 | 3300042620 | Bacteria | 1643 |
| 56 | Ga0466729_193937 | 3300042621 | Bacteria | 1380 |
| 57 | Ga0466703_007519 | 3300042636 | Bacteria | 18468 |
| 58 | Ga0466704_039200 | 3300042643 | Archaea | 1601 |
| 59 | Ga0466704_525927 | 3300042643 | Bacteria | 2215 |
| 60 | JGI24698J34947_10015233 | 3300002449 | Bacteria | 4188 |
| 61 | JGI24695J34938_10154176 | 3300002450 | Bacteria | 942 |
| 62 | Ga0072941_1020797 | 3300005201 | Bacteria | 8666 |
| 63 | Ga0466716_040372 | 3300042605 | Bacteria | 2065 |
| 64 | Ga0466716_104558 | 3300042605 | Bacteria | 1493 |
| 65 | Ga0466720_032268 | 3300042607 | Unclassified | 1609 |
| 66 | Ga0466705_103947 | 3300042612 | Bacteria | 1467 |
| 67 | Ga0466690_123082 | 3300042590 | Bacteria | 18470 |
| 68 | Ga0466696_503883 | 3300042596 | Bacteria | 1596 |
| 69 | Ga0466699_021144 | 3300042597 | Bacteria | 10741 |
| 70 | Ga0466699_189871 | 3300042597 | Bacteria | 2361 |
| 71 | Ga0466712_047062 | 3300042614 | Bacteria | 2239 |
| 72 | Ga0466711_326957 | 3300042615 | Bacteria | 8357 |
| 73 | Ga0466723_162917 | 3300042618 | Bacteria | 35021 |
| 74 | Ga0466726_147541 | 3300042619 | Bacteria | 36898 |
| 75 | Ga0466726_464232 | 3300042619 | Bacteria | 1493 |
| 76 | Ga0466735_015901 | 3300042624 | Bacteria | 13144 |
| 77 | Ga0466703_060348 | 3300042636 | Bacteria | 3784 |
| 78 | Ga0466704_383260 | 3300042643 | Bacteria | 1376 |
| 79 | Ga0466708_132603 | 3300042652 | Bacteria | 4403 |
| 80 | Ga0466708_354068 | 3300042652 | Bacteria | 9370 |
| 81 | Ga0466727_244686 | 3300042655 | Bacteria | 1879 |
| 82 | Ga0123354_10136991 | 3300010882 | Bacteria | 3054 |
| 83 | JGI24698J34947_10002224 | 3300002449 | Bacteria | 10391 |
| 84 | JGI24698J34947_10081978 | 3300002449 | Bacteria | 1510 |
| 85 | JGI24695J34938_10011218 | 3300002450 | Bacteria | 4842 |
| 86 | Ga0466707_298175 | 3300042601 | Bacteria | 2133 |
| 87 | Ga0466705_079520 | 3300042612 | Bacteria | 7398 |
| 88 | Ga0466733_175513 | 3300042659 | Bacteria | 2541 |
| 89 | Ga0415639_198108 | 3300038395 | Bacteria | 1787 |
| 90 | Ga0466692_196218 | 3300042591 | Bacteria | 1168 |
| 91 | Ga0466696_344226 | 3300042596 | Bacteria | 42875 |
| 92 | Ga0466699_402576 | 3300042597 | Bacteria | 1180 |
| 93 | Ga0466705_521189 | 3300042612 | Bacteria | 9208 |
| 94 | Ga0466728_049559 | 3300042620 | Bacteria | 3431 |
| 95 | Ga0466728_215584 | 3300042620 | Bacteria | 35980 |
| 96 | Ga0466735_064561 | 3300042624 | Bacteria | 1845 |
| 97 | Ga0466702_281872 | 3300042635 | Archaea | 1696 |
| 98 | Ga0466703_108983 | 3300042636 | Bacteria | 4170 |
| 99 | Ga0466704_024322 | 3300042643 | Bacteria | 8167 |
| 100 | Ga0466708_015128 | 3300042652 | Bacteria | 17319 |
| 101 | Ga0466727_206379 | 3300042655 | Bacteria | 5524 |
| 102 | Ga0466727_332785 | 3300042655 | Bacteria | 1912 |
| 103 | Ga0123353_10261756 | 3300010167 | Bacteria | 2671 |
| 104 | JGI24698J34947_10025444 | 3300002449 | Bacteria | 3150 |
| 105 | JGI24698J34947_10320611 | 3300002449 | Bacteria | 552 |
| 106 | JGI24695J34938_10000439 | 3300002450 | Bacteria | 40122 |
| 107 | Ga0466707_368602 | 3300042601 | Bacteria | 2023 |
| 108 | Ga0466707_374976 | 3300042601 | Bacteria | 2685 |
| 109 | Ga0466719_290670 | 3300042606 | Bacteria | 1504 |
| 110 | Ga0466719_543096 | 3300042606 | Bacteria | 1222 |
| 111 | Ga0466719_565676 | 3300042606 | Bacteria | 3676 |
| 112 | Ga0466698_286530 | 3300042610 | Bacteria | 2056 |
| 113 | Ga0466705_217361 | 3300042612 | Bacteria | 9764 |
| 114 | Ga0466695_348670 | 3300042595 | Bacteria | 1359 |
| 115 | Ga0466711_008196 | 3300042615 | Bacteria | 13342 |
| 116 | Ga0466723_076094 | 3300042618 | Bacteria | 6076 |
| 117 | Ga0466726_346202 | 3300042619 | Bacteria | 20777 |
| 118 | Ga0466726_464470 | 3300042619 | Unclassified | 1989 |
| 119 | Ga0466729_169791 | 3300042621 | Bacteria | 1439 |
| 120 | Ga0466703_093126 | 3300042636 | Bacteria | 24260 |
| 121 | Ga0466704_045000 | 3300042643 | Bacteria | 8583 |
| 122 | Ga0466704_157153 | 3300042643 | Bacteria | 3594 |
| 123 | Ga0466704_244943 | 3300042643 | Bacteria | 5262 |
| 124 | Ga0466704_379885 | 3300042643 | Bacteria | 13731 |
| 125 | Ga0466709_192733 | 3300042648 | Bacteria | 11921 |
| 126 | Ga0466708_399994 | 3300042652 | Bacteria | 2372 |
| 127 | Ga0466727_056333 | 3300042655 | Bacteria | 2318 |
| 128 | Ga0466727_164433 | 3300042655 | Bacteria | 1852 |
| 129 | JGI24695J34938_10015321 | 3300002450 | Bacteria | 3937 |
| 130 | Ga0074263_131640 | 3300005485 | Bacteria | 855 |
| 131 | Ga0466707_020083 | 3300042601 | Bacteria | 6190 |
| 132 | Ga0466707_384542 | 3300042601 | Bacteria | 1884 |
| 133 | Ga0466717_152264 | 3300042604 | Unclassified | 1277 |
| 134 | Ga0466716_087253 | 3300042605 | Bacteria | 9074 |
| 135 | Ga0466719_495967 | 3300042606 | Bacteria | 34420 |
| 136 | Ga0466720_033987 | 3300042607 | Bacteria | 15450 |
| 137 | Ga0466705_002993 | 3300042612 | Bacteria | 7262 |
| 138 | Ga0466705_050529 | 3300042612 | Bacteria | 30966 |
| 139 | Ga0466711_092404 | 3300042615 | Bacteria | 12551 |
| 140 | Ga0466726_267716 | 3300042619 | Bacteria | 1232 |
| 141 | Ga0466703_089018 | 3300042636 | Bacteria | 23207 |
| 142 | Ga0466703_171682 | 3300042636 | Bacteria | 6273 |
| 143 | Ga0466709_177960 | 3300042648 | Bacteria | 1003 |
| 144 | Ga0466708_455477 | 3300042652 | Bacteria | 1035 |
| 145 | Ga0466727_295022 | 3300042655 | Unclassified | 1104 |
| 146 | Nasutiter_FXBC724_g1 | 2030936001 | Bacteria | 840 |
| 147 | JGI24698J34947_10042709 | 3300002449 | Bacteria | 2328 |
| 148 | JGI24695J34938_10618409 | 3300002450 | Bacteria | 506 |
| 149 | Ga0466707_004785 | 3300042601 | Bacteria | 1175 |
| 150 | Ga0466707_144561 | 3300042601 | Unclassified | 1270 |
| 151 | Ga0466719_064947 | 3300042606 | Bacteria | 7541 |
| 152 | Ga0466720_075748 | 3300042607 | Bacteria | 3947 |
| 153 | Ga0223674_1026440 | 3300021235 | Bacteria | 828 |
| 154 | Ga0255786_1005936 | 3300022815 | Bacteria | 1852 |
| 155 | Ga0466692_165477 | 3300042591 | Bacteria | 28066 |
| 156 | Ga0466699_088523 | 3300042597 | Bacteria | 9273 |
| 157 | Ga0466699_392159 | 3300042597 | Bacteria | 1241 |
| 158 | Ga0466711_304685 | 3300042615 | Bacteria | 18501 |
| 159 | Ga0466723_013333 | 3300042618 | Bacteria | 24235 |
| 160 | Ga0466726_061649 | 3300042619 | Bacteria | 17192 |
| 161 | Ga0466726_375410 | 3300042619 | Bacteria | 11809 |
| 162 | Ga0466728_459415 | 3300042620 | Bacteria | 1928 |
| 163 | Ga0466735_194253 | 3300042624 | Bacteria | 1002 |
| 164 | Ga0466704_151929 | 3300042643 | Bacteria | 19167 |
| 165 | Ga0466709_083805 | 3300042648 | Bacteria | 22572 |
| 166 | Ga0466708_055457 | 3300042652 | Bacteria | 2102 |
| 167 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 168 | Ga0466727_220048 | 3300042655 | Bacteria | 1516 |
| 169 | Ga0123356_10002126 | 3300010049 | Bacteria | 21370 |
| 170 | Ga0466700_245731 | 3300042600 | Bacteria | 2122 |
| 171 | Ga0466722_115236 | 3300042609 | Bacteria | 8566 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.