Protein Family IF00559

Metagenome
131 Members
38 Samples
131 Scaffolds
162.55 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10103567|JGI24698J34947_101035671
Length
185 aa
Sequence
MPAKKYIVTLTKNEKALLNEIINKGKHSAEKRKRAQALLLAEKNYTDDMIAERTGLSRRGLEXLRQRFVEEGFEVTLAGKPRGHRPKALNGADEARLIALVCSPKPDGRTRWTLRLLADKWSTLAHTEVKTISRETVRRTLKKTKLNLGAARNGAYRRKKGQSLXPRWRIYWMCTPETMMKTVF*

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 88.9%
Kalotermitidae 5.6%
Termopsidae 2.8%
Unclassified 2.8%

🌳 Taxonomy

Archaea 3
Bacteria 58
Eukaryota 0
Viruses 0
Unclassified 70

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10188506 3300010167 Unclassified 3258
2 Ga0123353_10685413 3300010167 Unclassified 1442
3 Ga0123353_10901777 3300010167 Unclassified 1203
4 Ga0123354_10277160 3300010882 Bacteria 1637
5 Ga0466720_062795 3300042607 Unclassified 1343
6 Ga0466720_113380 3300042607 Unclassified 2042
7 Ga0466721_405204 3300042608 Bacteria 2265
8 Ga0466698_469849 3300042610 Unclassified 1173
9 Ga0466724_51957 3300042649 Bacteria 1343
10 Ga0466699_005756 3300042597 Bacteria 2584
11 JGI24695J34938_10422614 3300002450 Unclassified 598
12 JGI24702J35022_10194107 3300002462 Unclassified 1159
13 JGI24705J35276_11784493 3300002504 Unclassified 675
14 Ga0074263_116908 3300005485 Bacteria 2787
15 Ga0466718_017873 3300042617 Unclassified 1174
16 Ga0123356_11049825 3300010049 Unclassified 984
17 Ga0123353_10762588 3300010167 Unclassified 1344
18 Ga0123353_10808697 3300010167 Unclassified 1293
19 Ga0123353_10999011 3300010167 Unclassified 1124
20 Ga0123354_10249319 3300010882 Unclassified 1804
21 Ga0123354_10392804 3300010882 Unclassified 1183
22 Ga0466731_297089 3300042622 Bacteria 1181
23 Ga0466731_298515 3300042622 Bacteria 1077
24 Ga0466734_104717 3300042623 Unclassified 1331
25 Ga0466724_22976 3300042649 Archaea 1641
26 Ga0466725_019211 3300042654 Bacteria 1504
27 Ga0415639_017620 3300038395 Unclassified 1267
28 Ga0415639_050339 3300038395 Unclassified 1210
29 Ga0466694_191538 3300042594 Bacteria 1748
30 AustNasuHG_c1015894 3300000089 Bacteria 2530
31 JGI24698J34947_10110631 3300002449 Unclassified 1214
32 JGI24695J34938_10095780 3300002450 Bacteria 1215
33 JGI24695J34938_10338783 3300002450 Unclassified 658
34 JGI24695J34938_10581111 3300002450 Unclassified 520
35 JGI24696J40584_12828791 3300002834 Bacteria 925
36 Ga0466712_112028 3300042614 Unclassified 1665
37 Ga0466712_314215 3300042614 Bacteria 1028
38 Ga0123356_10299429 3300010049 Unclassified 1712
39 Ga0123356_10347374 3300010049 Unclassified 1606
40 Ga0123353_11315663 3300010167 Unclassified 937
41 Ga0466720_027206 3300042607 Bacteria 3230
42 Ga0466698_106720 3300042610 Unclassified 1437
43 Ga0466704_545871 3300042643 Bacteria 30505
44 Ga0264413_120567 3300024493 Bacteria 4012
45 Ga0415639_127455 3300038395 Unclassified 1145
46 Ga0466656_128224 3300042550 Unclassified 1705
47 Ga0466699_235314 3300042597 Unclassified 1477
48 Ga0466699_252780 3300042597 Bacteria 1071
49 AustNasuHG_c1028188 3300000089 Unclassified 1684
50 AustNasuHG_c1037015 3300000089 Unclassified 1255
51 JGI24698J34947_10103567 3300002449 Bacteria 1273
52 Ga0123357_10185494 3300009784 Bacteria 2414
53 Ga0123356_10238118 3300010049 Bacteria 1889
54 Ga0123353_10249616 3300010167 Unclassified 2749
55 Ga0123353_10768815 3300010167 Bacteria 1337
56 Ga0123353_10891274 3300010167 Unclassified 1213
57 Ga0123353_10918954 3300010167 Unclassified 1189
58 Ga0466707_063914 3300042601 Bacteria 1575
59 Ga0466717_095451 3300042604 Unclassified 1368
60 Ga0466698_105413 3300042610 Unclassified 1784
61 Ga0466698_487468 3300042610 Unclassified 1032
62 Ga0466731_363898 3300042622 Unclassified 1504
63 Ga0466727_323433 3300042655 Bacteria 1490
64 Ga0415639_017651 3300038395 Bacteria 1215
65 Ga0466694_164095 3300042594 Bacteria 1471
66 Ga0466695_191580 3300042595 Bacteria 1454
67 Ga0466699_236766 3300042597 Unclassified 1693
68 JGI24698J34947_10118274 3300002449 Unclassified 1156
69 JGI24695J34938_10066389 3300002450 Bacteria 1520
70 JGI24702J35022_10017994 3300002462 Unclassified 3857
71 JGI24696J40584_12906977 3300002834 Bacteria 1225
72 Ga0123356_10340493 3300010049 Bacteria 1620
73 Ga0123354_10552289 3300010882 Unclassified 868
74 Ga0466720_177499 3300042607 Bacteria 2478
75 Ga0466731_048680 3300042622 Bacteria 1042
76 Ga0466702_158748 3300042635 Bacteria 1426
77 Ga0466656_201354 3300042550 Bacteria 1360
78 Ga0466695_287374 3300042595 Unclassified 1038
79 JGI24698J34947_10101725 3300002449 Bacteria 1290
80 JGI24698J34947_10193835 3300002449 Bacteria 802
81 JGI24695J34938_10084592 3300002450 Bacteria 1307
82 JGI24695J34938_10094103 3300002450 Bacteria 1228
83 JGI24702J35022_10158703 3300002462 Unclassified 1273
84 JGI24705J35276_11516540 3300002504 Unclassified 562
85 Ga0072941_1263767 3300005201 Bacteria 1507
86 Ga0072941_1268254 3300005201 Unclassified 620
87 Ga0466712_187239 3300042614 Bacteria 1035
88 Ga0123356_10297625 3300010049 Unclassified 1717
89 Ga0123356_10386134 3300010049 Bacteria 1534
90 Ga0123356_10432637 3300010049 Unclassified 1460
91 Ga0123356_10498137 3300010049 Unclassified 1374
92 Ga0123353_10739855 3300010167 Unclassified 1371
93 Ga0123353_11042841 3300010167 Unclassified 1093
94 Ga0123354_10278247 3300010882 Unclassified 1631
95 Ga0466731_194882 3300042622 Bacteria 1430
96 Ga0415639_000834 3300038395 Unclassified 1582
97 Ga0415639_059356 3300038395 Unclassified 1293
98 JGI24698J34947_10160809 3300002449 Bacteria 920
99 Ga0466718_054648 3300042617 Bacteria 1508
100 Ga0123355_10413423 3300009826 Bacteria 1730
101 Ga0123353_11178489 3300010167 Unclassified 1008
102 Ga0123353_12005598 3300010167 Unclassified 709
103 Ga0466700_137633 3300042600 Bacteria 1698
104 Ga0466720_025405 3300042607 Unclassified 1357
105 Ga0466721_192264 3300042608 Unclassified 1873
106 Ga0466731_352751 3300042622 Unclassified 1359
107 Ga0466724_32784 3300042649 Unclassified 1124
108 Ga0466656_072303 3300042550 Bacteria 1019
109 Ga0466699_091552 3300042597 Bacteria 1212
110 AustNasuHG_c1040710 3300000089 Bacteria 1131
111 JGI24698J34947_10103988 3300002449 Bacteria 1269
112 Ga0466732_068829 3300042656 Bacteria 2150
113 Ga0466710_426026 3300042613 Bacteria 1337
114 Ga0123356_10141055 3300010049 Bacteria 2377
115 Ga0123356_10241700 3300010049 Unclassified 1877
116 Ga0123356_11692293 3300010049 Bacteria 785
117 Ga0123356_11790912 3300010049 Unclassified 763
118 Ga0123353_10410811 3300010167 Bacteria 2010
119 Ga0123353_10794467 3300010167 Unclassified 1308
120 Ga0123353_10834939 3300010167 Unclassified 1266
121 Ga0466717_112604 3300042604 Unclassified 1642
122 Ga0466720_023476 3300042607 Archaea 1158
123 Ga0466731_243492 3300042622 Unclassified 1029
124 Ga0466709_139993 3300042648 Bacteria 7069
125 Ga0466693_041957 3300042592 Unclassified 1375
126 Ga0466694_091030 3300042594 Bacteria 1495
127 Ga0466695_255188 3300042595 Bacteria 1164
128 Ga0466695_388147 3300042595 Archaea 1352
129 Ga0466699_413387 3300042597 Bacteria 1431
130 AustNasuHG_c1041088 3300000089 Unclassified 1120
131 JGI24695J34938_10079337 3300002450 Unclassified 1358

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_323433 Ga0466727_323433_156_602 148
2 3300010167 Ga0123353_10918954 Ga0123353_109189542 149
3 3300010882 Ga0123354_10552289 Ga0123354_105522892 149
4 3300038395 Ga0415639_050339 Ga0415639_050339_553_1002 149
5 3300038395 Ga0415639_059356 Ga0415639_059356_77_526 149
6 3300042622 Ga0466731_243492 Ga0466731_243492_122_571 149
7 3300002450 JGI24695J34938_10084592 JGI24695J34938_100845922 150
8 3300002834 JGI24696J40584_12906977 JGI24696J40584_129069771 150
9 3300010167 Ga0123353_10249616 Ga0123353_102496161 150
10 3300010167 Ga0123353_10410811 Ga0123353_104108112 150
11 3300010167 Ga0123353_10794467 Ga0123353_107944672 150
12 3300010882 Ga0123354_10277160 Ga0123354_102771602 150
13 3300010882 Ga0123354_10392804 Ga0123354_103928042 150
14 3300042614 Ga0466712_112028 Ga0466712_112028_433_885 150
15 3300042601 Ga0466707_063914 Ga0466707_063914_1055_1510 151
16 3300042622 Ga0466731_363898 Ga0466731_363898_851_1306 151
17 3300042604 Ga0466717_095451 Ga0466717_095451_151_645 155
18 3300042643 Ga0466704_545871 Ga0466704_545871_28192_28659 155
19 3300002450 JGI24695J34938_10079337 JGI24695J34938_100793372 156
20 3300002450 JGI24695J34938_10338783 JGI24695J34938_103387832 156
21 3300002450 JGI24695J34938_10422614 JGI24695J34938_104226141 156
22 3300002450 JGI24695J34938_10581111 JGI24695J34938_105811111 156
23 3300002834 JGI24696J40584_12828791 JGI24696J40584_128287911 156
24 3300042656 Ga0466732_068829 Ga0466732_068829_1472_1945 157
25 3300024493 Ga0264413_120567 Ga0264413_1205675 164
26 3300038395 Ga0415639_000834 Ga0415639_000834_884_1378 164
27 3300038395 Ga0415639_017620 Ga0415639_017620_130_624 164
28 3300038395 Ga0415639_017651 Ga0415639_017651_644_1138 164
29 3300038395 Ga0415639_127455 Ga0415639_127455_44_538 164
30 3300042550 Ga0466656_072303 Ga0466656_072303_427_921 164
31 3300042550 Ga0466656_128224 Ga0466656_128224_764_1258 164
32 3300042550 Ga0466656_201354 Ga0466656_201354_741_1235 164
33 3300042592 Ga0466693_041957 Ga0466693_041957_154_648 164
34 3300042594 Ga0466694_091030 Ga0466694_091030_362_856 164
35 3300042594 Ga0466694_164095 Ga0466694_164095_144_638 164
36 3300042594 Ga0466694_191538 Ga0466694_191538_420_914 164
37 3300042595 Ga0466695_191580 Ga0466695_191580_815_1309 164
38 3300042595 Ga0466695_255188 Ga0466695_255188_635_1129 164
39 3300042595 Ga0466695_287374 Ga0466695_287374_298_792 164
40 3300042595 Ga0466695_388147 Ga0466695_388147_743_1237 164
41 3300042597 Ga0466699_005756 Ga0466699_005756_389_883 164
42 3300042597 Ga0466699_091552 Ga0466699_091552_641_1135 164
43 3300042597 Ga0466699_236766 Ga0466699_236766_580_1074 164
44 3300042597 Ga0466699_252780 Ga0466699_252780_208_702 164
45 3300042597 Ga0466699_413387 Ga0466699_413387_183_677 164
46 3300042600 Ga0466700_137633 Ga0466700_137633_526_1020 164
47 3300042604 Ga0466717_112604 Ga0466717_112604_874_1368 164
48 3300042607 Ga0466720_023476 Ga0466720_023476_78_572 164
49 3300042607 Ga0466720_025405 Ga0466720_025405_220_714 164
50 3300042607 Ga0466720_027206 Ga0466720_027206_644_1138 164
51 3300042607 Ga0466720_062795 Ga0466720_062795_726_1220 164
52 3300042607 Ga0466720_177499 Ga0466720_177499_958_1452 164
53 3300042608 Ga0466721_192264 Ga0466721_192264_1050_1544 164
54 3300042608 Ga0466721_405204 Ga0466721_405204_1453_1947 164
55 3300042610 Ga0466698_105413 Ga0466698_105413_555_1049 164
56 3300042610 Ga0466698_106720 Ga0466698_106720_162_656 164
57 3300042610 Ga0466698_469849 Ga0466698_469849_347_841 164
58 3300042610 Ga0466698_487468 Ga0466698_487468_259_753 164
59 3300042613 Ga0466710_426026 Ga0466710_426026_119_613 164
60 3300042614 Ga0466712_187239 Ga0466712_187239_64_558 164
61 3300042614 Ga0466712_314215 Ga0466712_314215_362_856 164
62 3300042617 Ga0466718_017873 Ga0466718_017873_541_1035 164
63 3300042617 Ga0466718_054648 Ga0466718_054648_196_690 164
64 3300042622 Ga0466731_048680 Ga0466731_048680_88_582 164
65 3300042622 Ga0466731_194882 Ga0466731_194882_183_677 164
66 3300042622 Ga0466731_297089 Ga0466731_297089_518_1012 164
67 3300042622 Ga0466731_298515 Ga0466731_298515_435_929 164
68 3300042622 Ga0466731_352751 Ga0466731_352751_77_571 164
69 3300042635 Ga0466702_158748 Ga0466702_158748_739_1233 164
70 3300042648 Ga0466709_139993 Ga0466709_139993_5047_5541 164
71 3300042649 Ga0466724_22976 Ga0466724_22976_109_603 164
72 3300042649 Ga0466724_32784 Ga0466724_32784_109_603 164
73 3300042649 Ga0466724_51957 Ga0466724_51957_778_1272 164
74 3300000089 AustNasuHG_c1015894 AustNasuHG_10158942 165
75 3300000089 AustNasuHG_c1028188 AustNasuHG_10281882 165
76 3300000089 AustNasuHG_c1037015 AustNasuHG_10370152 165
77 3300000089 AustNasuHG_c1040710 AustNasuHG_10407102 165
78 3300000089 AustNasuHG_c1041088 AustNasuHG_10410882 165
79 3300002449 JGI24698J34947_10101725 JGI24698J34947_101017251 165
80 3300002449 JGI24698J34947_10103988 JGI24698J34947_101039882 165
81 3300002449 JGI24698J34947_10110631 JGI24698J34947_101106312 165
82 3300002449 JGI24698J34947_10118274 JGI24698J34947_101182742 165
83 3300002449 JGI24698J34947_10160809 JGI24698J34947_101608091 165
84 3300002449 JGI24698J34947_10193835 JGI24698J34947_101938352 165
85 3300002450 JGI24695J34938_10066389 JGI24695J34938_100663892 165
86 3300002450 JGI24695J34938_10094103 JGI24695J34938_100941031 165
87 3300002450 JGI24695J34938_10095780 JGI24695J34938_100957802 165
88 3300002462 JGI24702J35022_10017994 JGI24702J35022_100179942 165
89 3300002462 JGI24702J35022_10158703 JGI24702J35022_101587032 165
90 3300002462 JGI24702J35022_10194107 JGI24702J35022_101941071 165
91 3300002504 JGI24705J35276_11516540 JGI24705J35276_115165401 165
92 3300002504 JGI24705J35276_11784493 JGI24705J35276_117844931 165
93 3300005201 Ga0072941_1263767 Ga0072941_12637671 165
94 3300005201 Ga0072941_1268254 Ga0072941_12682541 165
95 3300005485 Ga0074263_116908 Ga0074263_1169083 165
96 3300009784 Ga0123357_10185494 Ga0123357_101854943 165
97 3300009826 Ga0123355_10413423 Ga0123355_104134232 165
98 3300010049 Ga0123356_10141055 Ga0123356_101410551 165
99 3300010049 Ga0123356_10238118 Ga0123356_102381183 165
100 3300010049 Ga0123356_10241700 Ga0123356_102417002 165
101 3300010049 Ga0123356_10297625 Ga0123356_102976253 165
102 3300010049 Ga0123356_10299429 Ga0123356_102994291 165
103 3300010049 Ga0123356_10340493 Ga0123356_103404932 165
104 3300010049 Ga0123356_10347374 Ga0123356_103473743 165
105 3300010049 Ga0123356_10386134 Ga0123356_103861342 165
106 3300010049 Ga0123356_10432637 Ga0123356_104326372 165
107 3300010049 Ga0123356_10498137 Ga0123356_104981372 165
108 3300010049 Ga0123356_11049825 Ga0123356_110498252 165
109 3300010049 Ga0123356_11692293 Ga0123356_116922931 165
110 3300010049 Ga0123356_11790912 Ga0123356_117909121 165
111 3300010167 Ga0123353_10188506 Ga0123353_101885062 165
112 3300010167 Ga0123353_10685413 Ga0123353_106854133 165
113 3300010167 Ga0123353_10739855 Ga0123353_107398552 165
114 3300010167 Ga0123353_10762588 Ga0123353_107625882 165
115 3300010167 Ga0123353_10768815 Ga0123353_107688151 165
116 3300010167 Ga0123353_10808697 Ga0123353_108086972 165
117 3300010167 Ga0123353_10834939 Ga0123353_108349392 165
118 3300010167 Ga0123353_10891274 Ga0123353_108912742 165
119 3300010167 Ga0123353_10901777 Ga0123353_109017771 165
120 3300010167 Ga0123353_10999011 Ga0123353_109990111 165
121 3300010167 Ga0123353_11042841 Ga0123353_110428411 165
122 3300010167 Ga0123353_11178489 Ga0123353_111784891 165
123 3300010167 Ga0123353_11315663 Ga0123353_113156632 165
124 3300010167 Ga0123353_12005598 Ga0123353_120055981 165
125 3300010882 Ga0123354_10249319 Ga0123354_102493191 165
126 3300010882 Ga0123354_10278247 Ga0123354_102782472 165
127 3300042623 Ga0466734_104717 Ga0466734_104717_126_623 165
128 3300042654 Ga0466725_019211 Ga0466725_019211_791_1288 165
129 3300042597 Ga0466699_235314 Ga0466699_235314_160_687 175
130 3300042607 Ga0466720_113380 Ga0466720_113380_640_1185 181
131 3300002449 JGI24698J34947_10103567 JGI24698J34947_101035671 185

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13384 HTH_23 Homeodomain-like domain 29 74 0.95
PF13565 HTH_32 Homeodomain-like domain 64 141 0.9
PF13551 HTH_29 Winged helix-turn helix 34 95 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.49 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.