Protein Family IF00557

Metagenome Isolate
116 Members
40 Samples
113 Scaffolds
264.25 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10098353|JGI24698J34947_100983532
Length
301 aa
Sequence
MKKLRNFLFAAISVAVAGVYMSRLFMLLPQNVRSFIVNPTVITVVITIATLTILGVALAVVLYLVAQKFKVFEDPRIDDVEAALPGANCGGCGYAGCRAFATAMVNAEXXSQLYCPVGGNSSMASVAKILGKTVAEKEPQVAVVRCNGSPEHRPKINRYEGASSXAIAAALYTGDTGCSFGCLGKGDCALSCKFDALYIDEKTGLPVVDEEKCTACGACVKACPKMIIELRKKGPKGRRIFVSCVNKDKGGIAKKACAACAYEAISIENNLAYIDWQKCKLAANTIWEVAFPPRKIAENG*

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 31.6%
Unclassified 10.5%
Termopsidae 7.9%
Rhinotermitidae 5.3%
Passalidae 5.3%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
15 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_092901 3300042618 Bacteria 12955
2 Ga0466723_107880 3300042618 Bacteria 32595
3 Ga0466692_004440 3300042591 Bacteria 16966
4 Ga0466695_251837 3300042595 Bacteria 1171
5 Ga0466696_166630 3300042596 Bacteria 4568
6 2227507944 2225789004 Bacteria 72999
7 IMNBL1DRAFT_c0025715 3300000062 Bacteria 2252
8 Ga0068302_10038014 3300005071 Unclassified 3936
9 Ga0068302_10372410 3300005071 Bacteria 1834
10 Ga0123353_10012963 3300010167 Bacteria 11906
11 Ga0123353_10153780 3300010167 Bacteria 3670
12 Ga0466723_198180 3300042618 Bacteria 8654
13 Ga0466728_184245 3300042620 Bacteria 9139
14 Ga0466696_088903 3300042596 Bacteria 11244
15 Ga0466696_331314 3300042596 Bacteria 16554
16 Ga0466703_225930 3300042636 Bacteria 8188
17 Ga0466704_123236 3300042643 Bacteria 13232
18 Ga0466709_228700 3300042648 Bacteria 33858
19 Ga0466708_100121 3300042652 Bacteria 17632
20 Ga0466708_316146 3300042652 Bacteria 1352
21 Ga0466706_155793 3300042599 Bacteria 34721
22 Ga0466714_023886 3300042603 Bacteria 17040
23 Ga0466698_059982 3300042610 Bacteria 1198
24 IMNBL1DRAFT_c0027536 3300000062 Bacteria 2135
25 JGI24698J34947_10098353 3300002449 Bacteria 1322
26 Ga0466733_053267 3300042659 Bacteria 6326
27 Ga0466733_106430 3300042659 Bacteria 6613
28 Ga0123354_10108138 3300010882 Bacteria 3697
29 Ga0466715_055007 3300042616 Bacteria 10861
30 Ga0466728_185506 3300042620 Bacteria 7738
31 Ga0466690_067989 3300042590 Bacteria 8676
32 Ga0466691_139689 3300042593 Bacteria 10329
33 Ga0466703_154026 3300042636 Bacteria 4061
34 Ga0466703_243599 3300042636 Bacteria 6340
35 Ga0466704_113992 3300042643 Bacteria 17348
36 Ga0466709_310600 3300042648 Bacteria 5701
37 Ga0466708_014735 3300042652 Bacteria 16198
38 Ga0466700_098408 3300042600 Bacteria 3081
39 Ga0466714_138895 3300042603 Bacteria 1388
40 Ga0466717_079545 3300042604 Bacteria 1309
41 Ga0466716_077437 3300042605 Bacteria 2480
42 Ga0466716_545032 3300042605 Bacteria 8993
43 Ga0466722_039112 3300042609 Bacteria 31390
44 Ga0466722_216697 3300042609 Bacteria 4069
45 2227080794 2225789004 Bacteria 41653
46 Ga0466705_215891 3300042612 Bacteria 32568
47 Ga0466733_196102 3300042659 Bacteria 12316
48 Ga0123356_10211155 3300010049 Bacteria 1990
49 Ga0123353_10596747 3300010167 Bacteria 1579
50 Ga0466711_052896 3300042615 Bacteria 4319
51 Ga0466728_076059 3300042620 Bacteria 1648
52 Ga0466690_346935 3300042590 Bacteria 7417
53 Ga0466696_072734 3300042596 Bacteria 18589
54 Ga0466696_112737 3300042596 Bacteria 8023
55 Ga0466708_347209 3300042652 Bacteria 9218
56 Ga0466714_090674 3300042603 Unclassified 3336
57 Ga0466716_326513 3300042605 Bacteria 5677
58 Ga0466722_029419 3300042609 Bacteria 8737
59 Ga0466722_146385 3300042609 Bacteria 8920
60 IMNBL1DRAFT_c0000082 3300000062 Bacteria 85768
61 JGI24702J35022_10011643 3300002462 Bacteria 4902
62 Ga0466733_149778 3300042659 Bacteria 16526
63 Ga0123356_10566973 3300010049 Bacteria 1298
64 Ga0123353_10385642 3300010167 Bacteria 2093
65 Ga0466711_089117 3300042615 Bacteria 39213
66 Ga0466726_083228 3300042619 Bacteria 9753
67 Ga0466728_172518 3300042620 Bacteria 6893
68 Ga0466690_272539 3300042590 Bacteria 5226
69 Ga0466691_068266 3300042593 Unclassified 3602
70 Ga0466694_120342 3300042594 Bacteria 1348
71 Ga0466696_008845 3300042596 Bacteria 9177
72 Ga0466703_104226 3300042636 Bacteria 3344
73 Ga0466704_092694 3300042643 Bacteria 2962
74 Ga0466714_051999 3300042603 Bacteria 3888
75 Ga0466719_549208 3300042606 Bacteria 3435
76 Ga0466698_129511 3300042610 Bacteria 2274
77 Ga0466733_031752 3300042659 Bacteria 4063
78 Ga0466733_171847 3300042659 Bacteria 8546
79 Ga0123353_10078267 3300010167 Bacteria 5314
80 Ga0466705_481018 3300042612 Bacteria 14394
81 Ga0466715_555928 3300042616 Bacteria 31902
82 Ga0466715_604799 3300042616 Bacteria 6645
83 Ga0466726_263484 3300042619 Bacteria 3438
84 Ga0466728_135763 3300042620 Bacteria 10186
85 Ga0265387_1003604 3300024582 Bacteria 2126
86 Ga0466691_110859 3300042593 Bacteria 30997
87 Ga0466704_049875 3300042643 Bacteria 80175
88 Ga0466709_257026 3300042648 Bacteria 19904
89 Ga0466714_024051 3300042603 Bacteria 1212
90 Ga0466714_091138 3300042603 Bacteria 6060
91 Ga0466719_355566 3300042606 Bacteria 10670
92 Ga0123356_10070220 3300010049 Unclassified 3285
93 Ga0123356_10086872 3300010049 Bacteria 2970
94 Ga0123353_10437721 3300010167 Bacteria 1930
95 Ga0466715_325310 3300042616 Bacteria 11304
96 Ga0466690_001791 3300042590 Bacteria 1040
97 Ga0466703_112508 3300042636 Bacteria 13987
98 Ga0466727_273508 3300042655 Bacteria 4590
99 Ga0466700_474282 3300042600 Bacteria 2964
100 Ga0466714_032748 3300042603 Bacteria 3415
101 Ga0466716_169138 3300042605 Bacteria 5844
102 Ga0466719_350196 3300042606 Bacteria 2325
103 Ga0068302_10152470 3300005071 Bacteria 3706
104 Ga0466733_195490 3300042659 Bacteria 2314
105 Ga0123353_10304868 3300010167 Bacteria 2428
106 Ga0123353_10569041 3300010167 Bacteria 1629
107 Ga0466711_295662 3300042615 Bacteria 6283
108 Ga0466723_188796 3300042618 Bacteria 5624
109 Ga0466690_141302 3300042590 Bacteria 9124
110 Ga0466703_046242 3300042636 Bacteria 15207
111 Ga0466709_015002 3300042648 Bacteria 10372
112 Ga0466713_006866 3300042602 Bacteria 27402
113 Ga0072941_1216862 3300005201 Bacteria 3319

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_474282 Ga0466700_474282_1025_1855 228
2 3300042604 Ga0466717_079545 Ga0466717_079545_108_950 229
3 3300042610 Ga0466698_129511 Ga0466698_129511_348_1199 230
4 3300042659 Ga0466733_053267 Ga0466733_053267_826_1701 231
5 3300010167 Ga0123353_10437721 Ga0123353_104377212 241
6 3300042606 Ga0466719_350196 Ga0466719_350196_896_1756 241
7 3300042636 Ga0466703_243599 Ga0466703_243599_891_1730 241
8 3300042596 Ga0466696_008845 Ga0466696_008845_508_1383 243
9 3300010167 Ga0123353_10569041 Ga0123353_105690411 244
10 3300042596 Ga0466696_072734 Ga0466696_072734_14148_15011 244
11 3300042648 Ga0466709_257026 Ga0466709_257026_13166_14053 244
12 3300010049 Ga0123356_10211155 Ga0123356_102111552 246
13 3300042616 Ga0466715_325310 Ga0466715_325310_5233_6099 247
14 3300042648 Ga0466709_228700 Ga0466709_228700_29971_30840 247
15 3300042652 Ga0466708_316146 Ga0466708_316146_243_1076 247
16 3300042643 Ga0466704_113992 Ga0466704_113992_3148_4047 248
17 3300010167 Ga0123353_10153780 Ga0123353_101537802 249
18 3300042594 Ga0466694_120342 Ga0466694_120342_195_1073 249
19 3300005071 Ga0068302_10152470 Ga0068302_101524705 250
20 3300010167 Ga0123353_10012963 Ga0123353_100129638 250
21 3300042600 Ga0466700_098408 Ga0466700_098408_2106_2948 250
22 3300042603 Ga0466714_138895 Ga0466714_138895_52_906 250
23 3300042609 Ga0466722_039112 Ga0466722_039112_30025_30879 250
24 3300042615 Ga0466711_052896 Ga0466711_052896_2824_3675 250
25 3300042619 Ga0466726_263484 Ga0466726_263484_535_1386 250
26 3300042636 Ga0466703_104226 Ga0466703_104226_2001_2843 250
27 3300005071 Ga0068302_10038014 Ga0068302_100380142 251
28 3300010167 Ga0123353_10304868 Ga0123353_103048682 251
29 3300042603 Ga0466714_090674 Ga0466714_090674_556_1422 251
30 3300010049 Ga0123356_10070220 Ga0123356_100702202 252
31 3300042603 Ga0466714_032748 Ga0466714_032748_411_1280 252
32 3300010167 Ga0123353_10385642 Ga0123353_103856423 254
33 3300010167 Ga0123353_10596747 Ga0123353_105967472 254
34 3300042603 Ga0466714_024051 Ga0466714_024051_256_1113 254
35 3300042659 Ga0466733_106430 Ga0466733_106430_2238_3089 254
36 3300010049 Ga0123356_10566973 Ga0123356_105669731 255
37 3300042591 Ga0466692_004440 Ga0466692_004440_14018_14875 255
38 3300042603 Ga0466714_051999 Ga0466714_051999_692_1552 255
39 3300042603 Ga0466714_091138 Ga0466714_091138_4761_5621 255
40 3300010882 Ga0123354_10108138 Ga0123354_101081382 256
41 3300042612 Ga0466705_215891 Ga0466705_215891_1876_2718 256
42 3300042643 Ga0466704_049875 Ga0466704_049875_62351_63214 256
43 3300042659 Ga0466733_149778 Ga0466733_149778_4355_5560 256
44 3300042609 Ga0466722_029419 Ga0466722_029419_2143_3009 257
45 3300042599 Ga0466706_155793 Ga0466706_155793_23591_24451 258
46 3300042609 Ga0466722_146385 Ga0466722_146385_929_1780 258
47 3300042595 Ga0466695_251837 Ga0466695_251837_110_928 261
48 3300042616 Ga0466715_055007 Ga0466715_055007_4438_5319 261
49 3300042620 Ga0466728_184245 Ga0466728_184245_4739_5581 261
50 3300042636 Ga0466703_112508 Ga0466703_112508_4971_5813 261
51 3300042596 Ga0466696_112737 Ga0466696_112737_5539_6381 262
52 3300042659 Ga0466733_195490 Ga0466733_195490_946_1803 262
53 3300010049 Ga0123356_10086872 Ga0123356_100868723 263
54 3300042636 Ga0466703_154026 Ga0466703_154026_844_1686 264
55 3300010167 Ga0123353_10078267 Ga0123353_100782674 265
56 3300024582 Ga0265387_1003604 Ga0265387_10036042 265
57 3300042603 Ga0466714_023886 Ga0466714_023886_3136_4005 265
58 3300042606 Ga0466719_355566 Ga0466719_355566_8434_9234 266
59 3300042655 Ga0466727_273508 Ga0466727_273508_3139_3990 266
60 3300042596 Ga0466696_331314 Ga0466696_331314_9314_10144 267
61 3300042609 Ga0466722_216697 Ga0466722_216697_1418_2266 267
62 3300042636 Ga0466703_225930 Ga0466703_225930_679_1548 268
63 3300042643 Ga0466704_123236 Ga0466704_123236_3131_4003 268
64 3300042606 Ga0466719_549208 Ga0466719_549208_2329_3171 269
65 3300042612 Ga0466705_481018 Ga0466705_481018_556_1443 269
66 3300042605 Ga0466716_169138 Ga0466716_169138_452_1294 270
67 3300042610 Ga0466698_059982 Ga0466698_059982_138_986 270
68 3300042618 Ga0466723_188796 Ga0466723_188796_2421_3263 270
69 3300042620 Ga0466728_172518 Ga0466728_172518_1274_2116 270
70 3300042620 Ga0466728_185506 Ga0466728_185506_3663_4508 270
71 3300042652 Ga0466708_100121 Ga0466708_100121_7342_8172 270
72 3300042590 Ga0466690_067989 Ga0466690_067989_754_1596 271
73 3300042616 Ga0466715_555928 Ga0466715_555928_2183_3022 272
74 3300042659 Ga0466733_196102 Ga0466733_196102_609_1499 272
75 3300005201 Ga0072941_1216862 Ga0072941_12168623 273
76 3300042605 Ga0466716_545032 Ga0466716_545032_4613_5455 273
77 3300042615 Ga0466711_089117 Ga0466711_089117_4542_5429 273
78 3300042636 Ga0466703_046242 Ga0466703_046242_8587_9474 273
79 3300042659 Ga0466733_031752 Ga0466733_031752_675_1529 273
80 2225789004 2227080794 2227454224 274
81 2225789004 2227507944 2227997757 274
82 3300005071 Ga0068302_10372410 Ga0068302_103724102 274
83 3300042590 Ga0466690_346935 Ga0466690_346935_3282_4124 275
84 3300042593 Ga0466691_139689 Ga0466691_139689_7829_8671 275
85 3300042596 Ga0466696_166630 Ga0466696_166630_1879_2739 275
86 3300000062 IMNBL1DRAFT_c0000082 IMNBL1DRAFT_000008275 276
87 3300000062 IMNBL1DRAFT_c0027536 IMNBL1DRAFT_00275362 276
88 3300002462 JGI24702J35022_10011643 JGI24702J35022_100116432 276
89 3300042590 Ga0466690_272539 Ga0466690_272539_3837_4688 278
90 3300042605 Ga0466716_326513 Ga0466716_326513_4233_5120 278
91 3300042593 Ga0466691_110859 Ga0466691_110859_19558_20433 279
92 3300042596 Ga0466696_088903 Ga0466696_088903_4849_5688 279
93 3300000062 IMNBL1DRAFT_c0025715 IMNBL1DRAFT_00257153 280
94 3300042590 Ga0466690_141302 Ga0466690_141302_1653_2495 280
95 3300042593 Ga0466691_068266 Ga0466691_068266_1767_2609 280
96 3300042605 Ga0466716_077437 Ga0466716_077437_451_1293 280
97 3300042615 Ga0466711_295662 Ga0466711_295662_3756_4598 280
98 3300042616 Ga0466715_604799 Ga0466715_604799_1933_2775 280
99 3300042618 Ga0466723_092901 Ga0466723_092901_10407_11249 280
100 3300042618 Ga0466723_107880 Ga0466723_107880_6461_7303 280
101 3300042618 Ga0466723_198180 Ga0466723_198180_2083_2925 280
102 3300042648 Ga0466709_015002 Ga0466709_015002_935_1777 280
103 3300042652 Ga0466708_014735 Ga0466708_014735_4709_5551 280
104 3300042602 Ga0466713_006866 Ga0466713_006866_9618_10589 281
105 3300042643 Ga0466704_092694 Ga0466704_092694_1630_2475 281
106 3300042648 Ga0466709_310600 Ga0466709_310600_4089_4949 281
107 3300042590 Ga0466690_001791 Ga0466690_001791_46_933 282
108 3300042620 Ga0466728_076059 Ga0466728_076059_11_898 282
109 3300042620 Ga0466728_135763 Ga0466728_135763_4830_5681 283
110 3300042659 Ga0466733_171847 Ga0466733_171847_5441_6337 283
111 iso_pr_bacteria 2820736622 2820737773 283
112 iso_pr_bacteria 2820740053 2820740392 283
113 3300042652 Ga0466708_347209 Ga0466708_347209_3314_4201 284
114 iso_pr_bacteria 2820781750 2820783377 295
115 3300042619 Ga0466726_083228 Ga0466726_083228_4802_5692 296
116 3300002449 JGI24698J34947_10098353 JGI24698J34947_100983532 301

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13237 Fer4_10 4Fe-4S dicluster domain 181 224 0.95
PF12797 Fer4_2 4Fe-4S binding domain 206 224 0.94
PF04060 FeS Putative Fe-S cluster 84 108 0.94
PF00037 Fer4 4Fe-4S binding domain 206 228 0.92
PF12837 Fer4_6 4Fe-4S binding domain 206 226 0.9
PF14697 Fer4_21 4Fe-4S dicluster domain 182 228 0.89
PF12838 Fer4_7 4Fe-4S dicluster domain 182 225 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04060 GO:0051536 iron-sulfur cluster binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.57 0.67 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.