Protein Family IF00557
Metagenome
Isolate
116
Members
40
Samples
113
Scaffolds
264.25
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10098353|JGI24698J34947_100983532
- Length
- 301 aa
- Sequence
- MKKLRNFLFAAISVAVAGVYMSRLFMLLPQNVRSFIVNPTVITVVITIATLTILGVALAVVLYLVAQKFKVFEDPRIDDVEAALPGANCGGCGYAGCRAFATAMVNAEXXSQLYCPVGGNSSMASVAKILGKTVAEKEPQVAVVRCNGSPEHRPKINRYEGASSXAIAAALYTGDTGCSFGCLGKGDCALSCKFDALYIDEKTGLPVVDEEKCTACGACVKACPKMIIELRKKGPKGRRIFVSCVNKDKGGIAKKACAACAYEAISIENNLAYIDWQKCKLAANTIWEVAFPPRKIAENG*
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
31.6%
Unclassified
10.5%
Termopsidae
7.9%
Rhinotermitidae
5.3%
Passalidae
5.3%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466723_092901 | 3300042618 | Bacteria | 12955 |
| 2 | Ga0466723_107880 | 3300042618 | Bacteria | 32595 |
| 3 | Ga0466692_004440 | 3300042591 | Bacteria | 16966 |
| 4 | Ga0466695_251837 | 3300042595 | Bacteria | 1171 |
| 5 | Ga0466696_166630 | 3300042596 | Bacteria | 4568 |
| 6 | 2227507944 | 2225789004 | Bacteria | 72999 |
| 7 | IMNBL1DRAFT_c0025715 | 3300000062 | Bacteria | 2252 |
| 8 | Ga0068302_10038014 | 3300005071 | Unclassified | 3936 |
| 9 | Ga0068302_10372410 | 3300005071 | Bacteria | 1834 |
| 10 | Ga0123353_10012963 | 3300010167 | Bacteria | 11906 |
| 11 | Ga0123353_10153780 | 3300010167 | Bacteria | 3670 |
| 12 | Ga0466723_198180 | 3300042618 | Bacteria | 8654 |
| 13 | Ga0466728_184245 | 3300042620 | Bacteria | 9139 |
| 14 | Ga0466696_088903 | 3300042596 | Bacteria | 11244 |
| 15 | Ga0466696_331314 | 3300042596 | Bacteria | 16554 |
| 16 | Ga0466703_225930 | 3300042636 | Bacteria | 8188 |
| 17 | Ga0466704_123236 | 3300042643 | Bacteria | 13232 |
| 18 | Ga0466709_228700 | 3300042648 | Bacteria | 33858 |
| 19 | Ga0466708_100121 | 3300042652 | Bacteria | 17632 |
| 20 | Ga0466708_316146 | 3300042652 | Bacteria | 1352 |
| 21 | Ga0466706_155793 | 3300042599 | Bacteria | 34721 |
| 22 | Ga0466714_023886 | 3300042603 | Bacteria | 17040 |
| 23 | Ga0466698_059982 | 3300042610 | Bacteria | 1198 |
| 24 | IMNBL1DRAFT_c0027536 | 3300000062 | Bacteria | 2135 |
| 25 | JGI24698J34947_10098353 | 3300002449 | Bacteria | 1322 |
| 26 | Ga0466733_053267 | 3300042659 | Bacteria | 6326 |
| 27 | Ga0466733_106430 | 3300042659 | Bacteria | 6613 |
| 28 | Ga0123354_10108138 | 3300010882 | Bacteria | 3697 |
| 29 | Ga0466715_055007 | 3300042616 | Bacteria | 10861 |
| 30 | Ga0466728_185506 | 3300042620 | Bacteria | 7738 |
| 31 | Ga0466690_067989 | 3300042590 | Bacteria | 8676 |
| 32 | Ga0466691_139689 | 3300042593 | Bacteria | 10329 |
| 33 | Ga0466703_154026 | 3300042636 | Bacteria | 4061 |
| 34 | Ga0466703_243599 | 3300042636 | Bacteria | 6340 |
| 35 | Ga0466704_113992 | 3300042643 | Bacteria | 17348 |
| 36 | Ga0466709_310600 | 3300042648 | Bacteria | 5701 |
| 37 | Ga0466708_014735 | 3300042652 | Bacteria | 16198 |
| 38 | Ga0466700_098408 | 3300042600 | Bacteria | 3081 |
| 39 | Ga0466714_138895 | 3300042603 | Bacteria | 1388 |
| 40 | Ga0466717_079545 | 3300042604 | Bacteria | 1309 |
| 41 | Ga0466716_077437 | 3300042605 | Bacteria | 2480 |
| 42 | Ga0466716_545032 | 3300042605 | Bacteria | 8993 |
| 43 | Ga0466722_039112 | 3300042609 | Bacteria | 31390 |
| 44 | Ga0466722_216697 | 3300042609 | Bacteria | 4069 |
| 45 | 2227080794 | 2225789004 | Bacteria | 41653 |
| 46 | Ga0466705_215891 | 3300042612 | Bacteria | 32568 |
| 47 | Ga0466733_196102 | 3300042659 | Bacteria | 12316 |
| 48 | Ga0123356_10211155 | 3300010049 | Bacteria | 1990 |
| 49 | Ga0123353_10596747 | 3300010167 | Bacteria | 1579 |
| 50 | Ga0466711_052896 | 3300042615 | Bacteria | 4319 |
| 51 | Ga0466728_076059 | 3300042620 | Bacteria | 1648 |
| 52 | Ga0466690_346935 | 3300042590 | Bacteria | 7417 |
| 53 | Ga0466696_072734 | 3300042596 | Bacteria | 18589 |
| 54 | Ga0466696_112737 | 3300042596 | Bacteria | 8023 |
| 55 | Ga0466708_347209 | 3300042652 | Bacteria | 9218 |
| 56 | Ga0466714_090674 | 3300042603 | Unclassified | 3336 |
| 57 | Ga0466716_326513 | 3300042605 | Bacteria | 5677 |
| 58 | Ga0466722_029419 | 3300042609 | Bacteria | 8737 |
| 59 | Ga0466722_146385 | 3300042609 | Bacteria | 8920 |
| 60 | IMNBL1DRAFT_c0000082 | 3300000062 | Bacteria | 85768 |
| 61 | JGI24702J35022_10011643 | 3300002462 | Bacteria | 4902 |
| 62 | Ga0466733_149778 | 3300042659 | Bacteria | 16526 |
| 63 | Ga0123356_10566973 | 3300010049 | Bacteria | 1298 |
| 64 | Ga0123353_10385642 | 3300010167 | Bacteria | 2093 |
| 65 | Ga0466711_089117 | 3300042615 | Bacteria | 39213 |
| 66 | Ga0466726_083228 | 3300042619 | Bacteria | 9753 |
| 67 | Ga0466728_172518 | 3300042620 | Bacteria | 6893 |
| 68 | Ga0466690_272539 | 3300042590 | Bacteria | 5226 |
| 69 | Ga0466691_068266 | 3300042593 | Unclassified | 3602 |
| 70 | Ga0466694_120342 | 3300042594 | Bacteria | 1348 |
| 71 | Ga0466696_008845 | 3300042596 | Bacteria | 9177 |
| 72 | Ga0466703_104226 | 3300042636 | Bacteria | 3344 |
| 73 | Ga0466704_092694 | 3300042643 | Bacteria | 2962 |
| 74 | Ga0466714_051999 | 3300042603 | Bacteria | 3888 |
| 75 | Ga0466719_549208 | 3300042606 | Bacteria | 3435 |
| 76 | Ga0466698_129511 | 3300042610 | Bacteria | 2274 |
| 77 | Ga0466733_031752 | 3300042659 | Bacteria | 4063 |
| 78 | Ga0466733_171847 | 3300042659 | Bacteria | 8546 |
| 79 | Ga0123353_10078267 | 3300010167 | Bacteria | 5314 |
| 80 | Ga0466705_481018 | 3300042612 | Bacteria | 14394 |
| 81 | Ga0466715_555928 | 3300042616 | Bacteria | 31902 |
| 82 | Ga0466715_604799 | 3300042616 | Bacteria | 6645 |
| 83 | Ga0466726_263484 | 3300042619 | Bacteria | 3438 |
| 84 | Ga0466728_135763 | 3300042620 | Bacteria | 10186 |
| 85 | Ga0265387_1003604 | 3300024582 | Bacteria | 2126 |
| 86 | Ga0466691_110859 | 3300042593 | Bacteria | 30997 |
| 87 | Ga0466704_049875 | 3300042643 | Bacteria | 80175 |
| 88 | Ga0466709_257026 | 3300042648 | Bacteria | 19904 |
| 89 | Ga0466714_024051 | 3300042603 | Bacteria | 1212 |
| 90 | Ga0466714_091138 | 3300042603 | Bacteria | 6060 |
| 91 | Ga0466719_355566 | 3300042606 | Bacteria | 10670 |
| 92 | Ga0123356_10070220 | 3300010049 | Unclassified | 3285 |
| 93 | Ga0123356_10086872 | 3300010049 | Bacteria | 2970 |
| 94 | Ga0123353_10437721 | 3300010167 | Bacteria | 1930 |
| 95 | Ga0466715_325310 | 3300042616 | Bacteria | 11304 |
| 96 | Ga0466690_001791 | 3300042590 | Bacteria | 1040 |
| 97 | Ga0466703_112508 | 3300042636 | Bacteria | 13987 |
| 98 | Ga0466727_273508 | 3300042655 | Bacteria | 4590 |
| 99 | Ga0466700_474282 | 3300042600 | Bacteria | 2964 |
| 100 | Ga0466714_032748 | 3300042603 | Bacteria | 3415 |
| 101 | Ga0466716_169138 | 3300042605 | Bacteria | 5844 |
| 102 | Ga0466719_350196 | 3300042606 | Bacteria | 2325 |
| 103 | Ga0068302_10152470 | 3300005071 | Bacteria | 3706 |
| 104 | Ga0466733_195490 | 3300042659 | Bacteria | 2314 |
| 105 | Ga0123353_10304868 | 3300010167 | Bacteria | 2428 |
| 106 | Ga0123353_10569041 | 3300010167 | Bacteria | 1629 |
| 107 | Ga0466711_295662 | 3300042615 | Bacteria | 6283 |
| 108 | Ga0466723_188796 | 3300042618 | Bacteria | 5624 |
| 109 | Ga0466690_141302 | 3300042590 | Bacteria | 9124 |
| 110 | Ga0466703_046242 | 3300042636 | Bacteria | 15207 |
| 111 | Ga0466709_015002 | 3300042648 | Bacteria | 10372 |
| 112 | Ga0466713_006866 | 3300042602 | Bacteria | 27402 |
| 113 | Ga0072941_1216862 | 3300005201 | Bacteria | 3319 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_474282 | Ga0466700_474282_1025_1855 | 228 |
| 2 | 3300042604 | Ga0466717_079545 | Ga0466717_079545_108_950 | 229 |
| 3 | 3300042610 | Ga0466698_129511 | Ga0466698_129511_348_1199 | 230 |
| 4 | 3300042659 | Ga0466733_053267 | Ga0466733_053267_826_1701 | 231 |
| 5 | 3300010167 | Ga0123353_10437721 | Ga0123353_104377212 | 241 |
| 6 | 3300042606 | Ga0466719_350196 | Ga0466719_350196_896_1756 | 241 |
| 7 | 3300042636 | Ga0466703_243599 | Ga0466703_243599_891_1730 | 241 |
| 8 | 3300042596 | Ga0466696_008845 | Ga0466696_008845_508_1383 | 243 |
| 9 | 3300010167 | Ga0123353_10569041 | Ga0123353_105690411 | 244 |
| 10 | 3300042596 | Ga0466696_072734 | Ga0466696_072734_14148_15011 | 244 |
| 11 | 3300042648 | Ga0466709_257026 | Ga0466709_257026_13166_14053 | 244 |
| 12 | 3300010049 | Ga0123356_10211155 | Ga0123356_102111552 | 246 |
| 13 | 3300042616 | Ga0466715_325310 | Ga0466715_325310_5233_6099 | 247 |
| 14 | 3300042648 | Ga0466709_228700 | Ga0466709_228700_29971_30840 | 247 |
| 15 | 3300042652 | Ga0466708_316146 | Ga0466708_316146_243_1076 | 247 |
| 16 | 3300042643 | Ga0466704_113992 | Ga0466704_113992_3148_4047 | 248 |
| 17 | 3300010167 | Ga0123353_10153780 | Ga0123353_101537802 | 249 |
| 18 | 3300042594 | Ga0466694_120342 | Ga0466694_120342_195_1073 | 249 |
| 19 | 3300005071 | Ga0068302_10152470 | Ga0068302_101524705 | 250 |
| 20 | 3300010167 | Ga0123353_10012963 | Ga0123353_100129638 | 250 |
| 21 | 3300042600 | Ga0466700_098408 | Ga0466700_098408_2106_2948 | 250 |
| 22 | 3300042603 | Ga0466714_138895 | Ga0466714_138895_52_906 | 250 |
| 23 | 3300042609 | Ga0466722_039112 | Ga0466722_039112_30025_30879 | 250 |
| 24 | 3300042615 | Ga0466711_052896 | Ga0466711_052896_2824_3675 | 250 |
| 25 | 3300042619 | Ga0466726_263484 | Ga0466726_263484_535_1386 | 250 |
| 26 | 3300042636 | Ga0466703_104226 | Ga0466703_104226_2001_2843 | 250 |
| 27 | 3300005071 | Ga0068302_10038014 | Ga0068302_100380142 | 251 |
| 28 | 3300010167 | Ga0123353_10304868 | Ga0123353_103048682 | 251 |
| 29 | 3300042603 | Ga0466714_090674 | Ga0466714_090674_556_1422 | 251 |
| 30 | 3300010049 | Ga0123356_10070220 | Ga0123356_100702202 | 252 |
| 31 | 3300042603 | Ga0466714_032748 | Ga0466714_032748_411_1280 | 252 |
| 32 | 3300010167 | Ga0123353_10385642 | Ga0123353_103856423 | 254 |
| 33 | 3300010167 | Ga0123353_10596747 | Ga0123353_105967472 | 254 |
| 34 | 3300042603 | Ga0466714_024051 | Ga0466714_024051_256_1113 | 254 |
| 35 | 3300042659 | Ga0466733_106430 | Ga0466733_106430_2238_3089 | 254 |
| 36 | 3300010049 | Ga0123356_10566973 | Ga0123356_105669731 | 255 |
| 37 | 3300042591 | Ga0466692_004440 | Ga0466692_004440_14018_14875 | 255 |
| 38 | 3300042603 | Ga0466714_051999 | Ga0466714_051999_692_1552 | 255 |
| 39 | 3300042603 | Ga0466714_091138 | Ga0466714_091138_4761_5621 | 255 |
| 40 | 3300010882 | Ga0123354_10108138 | Ga0123354_101081382 | 256 |
| 41 | 3300042612 | Ga0466705_215891 | Ga0466705_215891_1876_2718 | 256 |
| 42 | 3300042643 | Ga0466704_049875 | Ga0466704_049875_62351_63214 | 256 |
| 43 | 3300042659 | Ga0466733_149778 | Ga0466733_149778_4355_5560 | 256 |
| 44 | 3300042609 | Ga0466722_029419 | Ga0466722_029419_2143_3009 | 257 |
| 45 | 3300042599 | Ga0466706_155793 | Ga0466706_155793_23591_24451 | 258 |
| 46 | 3300042609 | Ga0466722_146385 | Ga0466722_146385_929_1780 | 258 |
| 47 | 3300042595 | Ga0466695_251837 | Ga0466695_251837_110_928 | 261 |
| 48 | 3300042616 | Ga0466715_055007 | Ga0466715_055007_4438_5319 | 261 |
| 49 | 3300042620 | Ga0466728_184245 | Ga0466728_184245_4739_5581 | 261 |
| 50 | 3300042636 | Ga0466703_112508 | Ga0466703_112508_4971_5813 | 261 |
| 51 | 3300042596 | Ga0466696_112737 | Ga0466696_112737_5539_6381 | 262 |
| 52 | 3300042659 | Ga0466733_195490 | Ga0466733_195490_946_1803 | 262 |
| 53 | 3300010049 | Ga0123356_10086872 | Ga0123356_100868723 | 263 |
| 54 | 3300042636 | Ga0466703_154026 | Ga0466703_154026_844_1686 | 264 |
| 55 | 3300010167 | Ga0123353_10078267 | Ga0123353_100782674 | 265 |
| 56 | 3300024582 | Ga0265387_1003604 | Ga0265387_10036042 | 265 |
| 57 | 3300042603 | Ga0466714_023886 | Ga0466714_023886_3136_4005 | 265 |
| 58 | 3300042606 | Ga0466719_355566 | Ga0466719_355566_8434_9234 | 266 |
| 59 | 3300042655 | Ga0466727_273508 | Ga0466727_273508_3139_3990 | 266 |
| 60 | 3300042596 | Ga0466696_331314 | Ga0466696_331314_9314_10144 | 267 |
| 61 | 3300042609 | Ga0466722_216697 | Ga0466722_216697_1418_2266 | 267 |
| 62 | 3300042636 | Ga0466703_225930 | Ga0466703_225930_679_1548 | 268 |
| 63 | 3300042643 | Ga0466704_123236 | Ga0466704_123236_3131_4003 | 268 |
| 64 | 3300042606 | Ga0466719_549208 | Ga0466719_549208_2329_3171 | 269 |
| 65 | 3300042612 | Ga0466705_481018 | Ga0466705_481018_556_1443 | 269 |
| 66 | 3300042605 | Ga0466716_169138 | Ga0466716_169138_452_1294 | 270 |
| 67 | 3300042610 | Ga0466698_059982 | Ga0466698_059982_138_986 | 270 |
| 68 | 3300042618 | Ga0466723_188796 | Ga0466723_188796_2421_3263 | 270 |
| 69 | 3300042620 | Ga0466728_172518 | Ga0466728_172518_1274_2116 | 270 |
| 70 | 3300042620 | Ga0466728_185506 | Ga0466728_185506_3663_4508 | 270 |
| 71 | 3300042652 | Ga0466708_100121 | Ga0466708_100121_7342_8172 | 270 |
| 72 | 3300042590 | Ga0466690_067989 | Ga0466690_067989_754_1596 | 271 |
| 73 | 3300042616 | Ga0466715_555928 | Ga0466715_555928_2183_3022 | 272 |
| 74 | 3300042659 | Ga0466733_196102 | Ga0466733_196102_609_1499 | 272 |
| 75 | 3300005201 | Ga0072941_1216862 | Ga0072941_12168623 | 273 |
| 76 | 3300042605 | Ga0466716_545032 | Ga0466716_545032_4613_5455 | 273 |
| 77 | 3300042615 | Ga0466711_089117 | Ga0466711_089117_4542_5429 | 273 |
| 78 | 3300042636 | Ga0466703_046242 | Ga0466703_046242_8587_9474 | 273 |
| 79 | 3300042659 | Ga0466733_031752 | Ga0466733_031752_675_1529 | 273 |
| 80 | 2225789004 | 2227080794 | 2227454224 | 274 |
| 81 | 2225789004 | 2227507944 | 2227997757 | 274 |
| 82 | 3300005071 | Ga0068302_10372410 | Ga0068302_103724102 | 274 |
| 83 | 3300042590 | Ga0466690_346935 | Ga0466690_346935_3282_4124 | 275 |
| 84 | 3300042593 | Ga0466691_139689 | Ga0466691_139689_7829_8671 | 275 |
| 85 | 3300042596 | Ga0466696_166630 | Ga0466696_166630_1879_2739 | 275 |
| 86 | 3300000062 | IMNBL1DRAFT_c0000082 | IMNBL1DRAFT_000008275 | 276 |
| 87 | 3300000062 | IMNBL1DRAFT_c0027536 | IMNBL1DRAFT_00275362 | 276 |
| 88 | 3300002462 | JGI24702J35022_10011643 | JGI24702J35022_100116432 | 276 |
| 89 | 3300042590 | Ga0466690_272539 | Ga0466690_272539_3837_4688 | 278 |
| 90 | 3300042605 | Ga0466716_326513 | Ga0466716_326513_4233_5120 | 278 |
| 91 | 3300042593 | Ga0466691_110859 | Ga0466691_110859_19558_20433 | 279 |
| 92 | 3300042596 | Ga0466696_088903 | Ga0466696_088903_4849_5688 | 279 |
| 93 | 3300000062 | IMNBL1DRAFT_c0025715 | IMNBL1DRAFT_00257153 | 280 |
| 94 | 3300042590 | Ga0466690_141302 | Ga0466690_141302_1653_2495 | 280 |
| 95 | 3300042593 | Ga0466691_068266 | Ga0466691_068266_1767_2609 | 280 |
| 96 | 3300042605 | Ga0466716_077437 | Ga0466716_077437_451_1293 | 280 |
| 97 | 3300042615 | Ga0466711_295662 | Ga0466711_295662_3756_4598 | 280 |
| 98 | 3300042616 | Ga0466715_604799 | Ga0466715_604799_1933_2775 | 280 |
| 99 | 3300042618 | Ga0466723_092901 | Ga0466723_092901_10407_11249 | 280 |
| 100 | 3300042618 | Ga0466723_107880 | Ga0466723_107880_6461_7303 | 280 |
| 101 | 3300042618 | Ga0466723_198180 | Ga0466723_198180_2083_2925 | 280 |
| 102 | 3300042648 | Ga0466709_015002 | Ga0466709_015002_935_1777 | 280 |
| 103 | 3300042652 | Ga0466708_014735 | Ga0466708_014735_4709_5551 | 280 |
| 104 | 3300042602 | Ga0466713_006866 | Ga0466713_006866_9618_10589 | 281 |
| 105 | 3300042643 | Ga0466704_092694 | Ga0466704_092694_1630_2475 | 281 |
| 106 | 3300042648 | Ga0466709_310600 | Ga0466709_310600_4089_4949 | 281 |
| 107 | 3300042590 | Ga0466690_001791 | Ga0466690_001791_46_933 | 282 |
| 108 | 3300042620 | Ga0466728_076059 | Ga0466728_076059_11_898 | 282 |
| 109 | 3300042620 | Ga0466728_135763 | Ga0466728_135763_4830_5681 | 283 |
| 110 | 3300042659 | Ga0466733_171847 | Ga0466733_171847_5441_6337 | 283 |
| 111 | iso_pr_bacteria | 2820736622 | 2820737773 | 283 |
| 112 | iso_pr_bacteria | 2820740053 | 2820740392 | 283 |
| 113 | 3300042652 | Ga0466708_347209 | Ga0466708_347209_3314_4201 | 284 |
| 114 | iso_pr_bacteria | 2820781750 | 2820783377 | 295 |
| 115 | 3300042619 | Ga0466726_083228 | Ga0466726_083228_4802_5692 | 296 |
| 116 | 3300002449 | JGI24698J34947_10098353 | JGI24698J34947_100983532 | 301 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13237 | Fer4_10 | 4Fe-4S dicluster domain | 181 | 224 | 0.95 |
| PF12797 | Fer4_2 | 4Fe-4S binding domain | 206 | 224 | 0.94 |
| PF04060 | FeS | Putative Fe-S cluster | 84 | 108 | 0.94 |
| PF00037 | Fer4 | 4Fe-4S binding domain | 206 | 228 | 0.92 |
| PF12837 | Fer4_6 | 4Fe-4S binding domain | 206 | 226 | 0.9 |
| PF14697 | Fer4_21 | 4Fe-4S dicluster domain | 182 | 228 | 0.89 |
| PF12838 | Fer4_7 | 4Fe-4S dicluster domain | 182 | 225 | 0.88 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04060 | GO:0051536 | iron-sulfur cluster binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.57 | 0.67 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.