Protein Family IF00507
Metagenome
Isolate
158
Members
37
Samples
157
Scaffolds
159.01
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10013262|JGI24698J34947_100132622
- Length
- 153 aa
- Sequence
- MKTAVVYYSLDGNCALVAEELKARLNADLISLHTKDEKKRGKMGKFFWGHKKPPLKPYTXDASAYDLIILGVPVWAGSPAPPIQTFISKAGITGKKIALFVCHGGGKGKAVKKFKSLLAGNEIAATADFIDPSKDNSENVKQKIADWVKGLG*
Sample Types
Isolate
0.6%
Metagenome
99.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.9%
Kalotermitidae
17.1%
Rhinotermitidae
8.6%
Unclassified
5.7%
Termopsidae
5.7%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_043172 | 3300042614 | Bacteria | 26342 |
| 2 | Ga0466712_311658 | 3300042614 | Bacteria | 1492 |
| 3 | Ga0264413_102064 | 3300024493 | Bacteria | 14247 |
| 4 | Ga0264413_137022 | 3300024493 | Unclassified | 1256 |
| 5 | Ga0466694_227978 | 3300042594 | Bacteria | 1619 |
| 6 | Ga0466699_085763 | 3300042597 | Bacteria | 1295 |
| 7 | Ga0466699_101402 | 3300042597 | Bacteria | 8220 |
| 8 | JGI24698J34947_10013262 | 3300002449 | Bacteria | 4502 |
| 9 | JGI24698J34947_10013866 | 3300002449 | Bacteria | 4394 |
| 10 | JGI24698J34947_10027795 | 3300002449 | Bacteria | 3000 |
| 11 | JGI24698J34947_10034498 | 3300002449 | Unclassified | 2647 |
| 12 | JGI24698J34947_10056990 | 3300002449 | Bacteria | 1940 |
| 13 | Ga0072940_1021835 | 3300005200 | Bacteria | 6701 |
| 14 | Ga0072941_1069984 | 3300005201 | Bacteria | 1116 |
| 15 | Ga0072941_1100072 | 3300005201 | Bacteria | 1166 |
| 16 | Ga0074263_125421 | 3300005485 | Bacteria | 813 |
| 17 | Ga0466720_056703 | 3300042607 | Bacteria | 3185 |
| 18 | Ga0466720_174085 | 3300042607 | Bacteria | 1069 |
| 19 | Ga0466722_034565 | 3300042609 | Bacteria | 1418 |
| 20 | Ga0466698_137475 | 3300042610 | Bacteria | 1113 |
| 21 | Ga0466731_215291 | 3300042622 | Bacteria | 2196 |
| 22 | Ga0466731_216415 | 3300042622 | Bacteria | 5933 |
| 23 | Ga0466712_051468 | 3300042614 | Bacteria | 8017 |
| 24 | Ga0466712_125004 | 3300042614 | Bacteria | 1511 |
| 25 | Ga0466712_137831 | 3300042614 | Bacteria | 4524 |
| 26 | Ga0466712_181397 | 3300042614 | Bacteria | 1375 |
| 27 | Ga0466712_227933 | 3300042614 | Bacteria | 5601 |
| 28 | Ga0123356_10593394 | 3300010049 | Bacteria | 1272 |
| 29 | JGI24698J34947_10010974 | 3300002449 | Bacteria | 4972 |
| 30 | JGI24698J34947_10019508 | 3300002449 | Bacteria | 3657 |
| 31 | JGI24698J34947_10022057 | 3300002449 | Bacteria | 3418 |
| 32 | JGI24698J34947_10069873 | 3300002449 | Bacteria | 1693 |
| 33 | Ga0072940_1523624 | 3300005200 | Bacteria | 686 |
| 34 | Ga0072941_1037204 | 3300005201 | Unclassified | 2910 |
| 35 | Ga0466720_025680 | 3300042607 | Bacteria | 2545 |
| 36 | Ga0466722_073580 | 3300042609 | Bacteria | 2361 |
| 37 | Ga0466722_244865 | 3300042609 | Bacteria | 4346 |
| 38 | Ga0466698_211053 | 3300042610 | Bacteria | 1055 |
| 39 | Ga0466712_010396 | 3300042614 | Bacteria | 1005 |
| 40 | Ga0466712_019223 | 3300042614 | Bacteria | 2862 |
| 41 | Ga0466712_264329 | 3300042614 | Bacteria | 5220 |
| 42 | Ga0466718_007833 | 3300042617 | Bacteria | 2020 |
| 43 | Ga0466694_011759 | 3300042594 | Bacteria | 7812 |
| 44 | JGI24698J34947_10020605 | 3300002449 | Bacteria | 3550 |
| 45 | JGI24698J34947_10022094 | 3300002449 | Bacteria | 3414 |
| 46 | Ga0072941_1002420 | 3300005201 | Bacteria | 7086 |
| 47 | Ga0072941_1018111 | 3300005201 | Bacteria | 3896 |
| 48 | Ga0072941_1133819 | 3300005201 | Bacteria | 868 |
| 49 | Ga0466720_118379 | 3300042607 | Bacteria | 14999 |
| 50 | Ga0466735_183914 | 3300042624 | Bacteria | 2055 |
| 51 | Ga0466704_115508 | 3300042643 | Bacteria | 7021 |
| 52 | Ga0466727_218192 | 3300042655 | Bacteria | 1064 |
| 53 | Ga0466715_353246 | 3300042616 | Bacteria | 15465 |
| 54 | Ga0466718_020102 | 3300042617 | Bacteria | 33451 |
| 55 | Ga0466718_079127 | 3300042617 | Bacteria | 6669 |
| 56 | Ga0264413_137148 | 3300024493 | Bacteria | 1172 |
| 57 | Ga0466692_062046 | 3300042591 | Bacteria | 1409 |
| 58 | Ga0466699_048394 | 3300042597 | Bacteria | 3069 |
| 59 | Ga0466699_057278 | 3300042597 | Bacteria | 7865 |
| 60 | Ga0466699_301809 | 3300042597 | Bacteria | 1420 |
| 61 | JGI24698J34947_10031851 | 3300002449 | Bacteria | 2772 |
| 62 | JGI24698J34947_10075573 | 3300002449 | Bacteria | 1601 |
| 63 | JGI24695J34938_10002345 | 3300002450 | Bacteria | 14578 |
| 64 | JGI24699J35502_11117181 | 3300002509 | Unclassified | 3014 |
| 65 | Ga0072941_1018477 | 3300005201 | Bacteria | 5821 |
| 66 | Ga0072941_1069981 | 3300005201 | Unclassified | 1320 |
| 67 | Ga0072941_1113082 | 3300005201 | Bacteria | 1425 |
| 68 | Ga0466717_019740 | 3300042604 | Bacteria | 1952 |
| 69 | Ga0466732_108517 | 3300042656 | Bacteria | 3743 |
| 70 | Ga0466705_488410 | 3300042612 | Bacteria | 10114 |
| 71 | Ga0466712_042010 | 3300042614 | Bacteria | 1593 |
| 72 | Ga0466712_214818 | 3300042614 | Unclassified | 5548 |
| 73 | Ga0466711_065960 | 3300042615 | Bacteria | 2531 |
| 74 | Ga0466718_047665 | 3300042617 | Bacteria | 1349 |
| 75 | Ga0264413_100793 | 3300024493 | Bacteria | 22082 |
| 76 | Ga0466692_158260 | 3300042591 | Bacteria | 1607 |
| 77 | Ga0466699_325639 | 3300042597 | Bacteria | 7847 |
| 78 | AustNasuHG_c1054135 | 3300000089 | Bacteria | 827 |
| 79 | JGI24698J34947_10039827 | 3300002449 | Bacteria | 2431 |
| 80 | JGI24698J34947_10043805 | 3300002449 | Bacteria | 2293 |
| 81 | Ga0072941_1000873 | 3300005201 | Bacteria | 15327 |
| 82 | Ga0072941_1001880 | 3300005201 | Bacteria | 6511 |
| 83 | Ga0072941_1055798 | 3300005201 | Bacteria | 2271 |
| 84 | Ga0072941_1069983 | 3300005201 | Bacteria | 1889 |
| 85 | Ga0466701_057646 | 3300042598 | Unclassified | 1301 |
| 86 | Ga0466707_405728 | 3300042601 | Bacteria | 1222 |
| 87 | Ga0466720_090158 | 3300042607 | Bacteria | 4278 |
| 88 | Ga0466708_385495 | 3300042652 | Bacteria | 3160 |
| 89 | Ga0466712_010617 | 3300042614 | Bacteria | 27865 |
| 90 | Ga0466712_023799 | 3300042614 | Bacteria | 49566 |
| 91 | Ga0466712_037176 | 3300042614 | Bacteria | 5377 |
| 92 | Ga0466712_065912 | 3300042614 | Bacteria | 9425 |
| 93 | Ga0466712_131301 | 3300042614 | Bacteria | 6839 |
| 94 | Ga0466712_206519 | 3300042614 | Bacteria | 14431 |
| 95 | Ga0466712_296740 | 3300042614 | Bacteria | 3398 |
| 96 | Ga0466712_323520 | 3300042614 | Bacteria | 2015 |
| 97 | Ga0466715_121577 | 3300042616 | Bacteria | 6400 |
| 98 | Ga0466699_030190 | 3300042597 | Bacteria | 1283 |
| 99 | Ga0123355_10071798 | 3300009826 | Bacteria | 5555 |
| 100 | Ga0123356_12188857 | 3300010049 | Bacteria | 691 |
| 101 | AustNasuHG_c1014434 | 3300000089 | Bacteria | 2687 |
| 102 | JGI24698J34947_10014774 | 3300002449 | Bacteria | 4252 |
| 103 | JGI24698J34947_10045736 | 3300002449 | Unclassified | 2231 |
| 104 | JGI24698J34947_10108172 | 3300002449 | Bacteria | 1233 |
| 105 | JGI24698J34947_10136717 | 3300002449 | Bacteria | 1039 |
| 106 | JGI24698J34947_10238658 | 3300002449 | Bacteria | 686 |
| 107 | Ga0072941_1014027 | 3300005201 | Bacteria | 15119 |
| 108 | Ga0072941_1047327 | 3300005201 | Bacteria | 6166 |
| 109 | Ga0072941_1112230 | 3300005201 | Bacteria | 2049 |
| 110 | Ga0466700_463537 | 3300042600 | Bacteria | 6482 |
| 111 | Ga0466720_009214 | 3300042607 | Bacteria | 5346 |
| 112 | Ga0466722_034421 | 3300042609 | Bacteria | 3907 |
| 113 | Ga0466722_201400 | 3300042609 | Bacteria | 6111 |
| 114 | Ga0466712_183454 | 3300042614 | Bacteria | 22573 |
| 115 | Ga0466718_113201 | 3300042617 | Bacteria | 6308 |
| 116 | Ga0264413_100338 | 3300024493 | Unclassified | 2171 |
| 117 | Ga0456237_0002855 | 3300041968 | Bacteria | 2802 |
| 118 | Ga0466694_397705 | 3300042594 | Unclassified | 1012 |
| 119 | Ga0466699_295040 | 3300042597 | Bacteria | 23711 |
| 120 | Ga0123356_10000592 | 3300010049 | Bacteria | 40159 |
| 121 | Ga0123356_10619493 | 3300010049 | Bacteria | 1248 |
| 122 | Ga0123353_10418013 | 3300010167 | Bacteria | 1988 |
| 123 | JGI24698J34947_10054875 | 3300002449 | Bacteria | 1987 |
| 124 | JGI24698J34947_10055101 | 3300002449 | Bacteria | 1982 |
| 125 | JGI24697J35500_11268262 | 3300002507 | Unclassified | 3782 |
| 126 | Ga0072941_1007170 | 3300005201 | Bacteria | 10080 |
| 127 | Ga0072941_1014093 | 3300005201 | Bacteria | 10180 |
| 128 | Ga0072941_1135829 | 3300005201 | Bacteria | 2562 |
| 129 | Ga0466720_049630 | 3300042607 | Bacteria | 7959 |
| 130 | Ga0466720_155586 | 3300042607 | Bacteria | 3015 |
| 131 | Ga0466698_156689 | 3300042610 | Bacteria | 3971 |
| 132 | Ga0466731_280469 | 3300042622 | Bacteria | 1444 |
| 133 | Ga0466702_349089 | 3300042635 | Bacteria | 1129 |
| 134 | Ga0466712_066856 | 3300042614 | Unclassified | 1071 |
| 135 | Ga0466718_002203 | 3300042617 | Bacteria | 1921 |
| 136 | Ga0466718_031708 | 3300042617 | Bacteria | 3476 |
| 137 | Ga0466718_037177 | 3300042617 | Bacteria | 28595 |
| 138 | Ga0466718_059196 | 3300042617 | Bacteria | 11472 |
| 139 | Ga0466718_158948 | 3300042617 | Bacteria | 3536 |
| 140 | Ga0466699_058044 | 3300042597 | Bacteria | 5391 |
| 141 | Ga0466699_436381 | 3300042597 | Bacteria | 1514 |
| 142 | Ga0123356_10137259 | 3300010049 | Bacteria | 2406 |
| 143 | JGI24698J34947_10001365 | 3300002449 | Bacteria | 12835 |
| 144 | JGI24698J34947_10010829 | 3300002449 | Bacteria | 5005 |
| 145 | JGI24698J34947_10053047 | 3300002449 | Bacteria | 2031 |
| 146 | JGI24698J34947_10070310 | 3300002449 | Bacteria | 1685 |
| 147 | JGI24699J35502_11130823 | 3300002509 | Bacteria | 5302 |
| 148 | Ga0072941_1041398 | 3300005201 | Bacteria | 6203 |
| 149 | Ga0072941_1288734 | 3300005201 | Bacteria | 653 |
| 150 | Ga0466716_041067 | 3300042605 | Bacteria | 24843 |
| 151 | Ga0466720_024566 | 3300042607 | Unclassified | 1012 |
| 152 | Ga0466720_046475 | 3300042607 | Bacteria | 14856 |
| 153 | Ga0466720_103447 | 3300042607 | Bacteria | 1618 |
| 154 | Ga0466722_178205 | 3300042609 | Bacteria | 2657 |
| 155 | Ga0466731_000239 | 3300042622 | Bacteria | 4355 |
| 156 | Ga0466731_111755 | 3300042622 | Bacteria | 21719 |
| 157 | Ga0466702_319172 | 3300042635 | Bacteria | 1353 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03358 | GO:0016491 | oxidoreductase activity | MF |
| PF12682 | GO:0010181 | FMN binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.