Protein Family IF00500
Metagenome
Isolate
181
Members
55
Samples
172
Scaffolds
256.03
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10010492|JGI24698J34947_100104922
- Length
- 299 aa
- Sequence
- MGSLWSLISKKCLKTVFFAFFLFKLGKARQTPRPSRVAGIYSVMALTTRKLDEFFRGLLDIEGFKAADSSLNGLQVDNDGAEIGKVAFAVDASLETFKRAAEAGAGLLFVHHGLFWGVPLRLEKNNRERIKFLLDNNLALYGVHLPLDQHPQFGNCAVLAELLGIKEKEPFGVYAGHKIGYKGKLSTPLTVDDAVKKIAFMDRPPLGVFPFGKKENITCGVVSGGAAKEAFQAIDEGLDLYVTGEFSHMIYHHALECRMNVIAGGHYSTEVWGVRCIMRECANQLGIAAEFIDIPTGL*
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.4%
Kalotermitidae
24.5%
Unclassified
17.0%
Rhinotermitidae
7.5%
Termopsidae
5.7%
Blaberidae
1.9%
Taxonomy
Archaea
2
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 10 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 13 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 14 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 15 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 33 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 2820150510 | Unclassified Proteobacteria Emb289P1bin35 | Isolate | Unclassified |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_038376 | 3300042656 | Bacteria | 1637 |
| 2 | Ga0466732_393089 | 3300042656 | Bacteria | 3815 |
| 3 | Ga0466701_036703 | 3300042598 | Bacteria | 1014 |
| 4 | Ga0466700_337683 | 3300042600 | Bacteria | 1502 |
| 5 | Ga0466716_074222 | 3300042605 | Bacteria | 1749 |
| 6 | Ga0466719_011256 | 3300042606 | Bacteria | 20714 |
| 7 | Ga0466719_539619 | 3300042606 | Bacteria | 13898 |
| 8 | Ga0466720_168387 | 3300042607 | Bacteria | 2134 |
| 9 | Ga0466722_136278 | 3300042609 | Bacteria | 4055 |
| 10 | Ga0466722_139691 | 3300042609 | Bacteria | 5703 |
| 11 | Ga0123357_10166617 | 3300009784 | Bacteria | 2621 |
| 12 | Ga0466703_316903 | 3300042636 | Bacteria | 9219 |
| 13 | Ga0466709_037610 | 3300042648 | Bacteria | 5130 |
| 14 | Ga0466709_301140 | 3300042648 | Bacteria | 3992 |
| 15 | Ga0466709_385279 | 3300042648 | Bacteria | 8131 |
| 16 | Ga0466727_092552 | 3300042655 | Bacteria | 3915 |
| 17 | Ga0264413_117112 | 3300024493 | Bacteria | 9748 |
| 18 | Ga0466694_040298 | 3300042594 | Bacteria | 14270 |
| 19 | Ga0466699_296169 | 3300042597 | Bacteria | 1958 |
| 20 | Ga0466718_155999 | 3300042617 | Bacteria | 4627 |
| 21 | Ga0466723_116947 | 3300042618 | Bacteria | 88879 |
| 22 | Ga0466728_150622 | 3300042620 | Bacteria | 6583 |
| 23 | Ga0466705_064661 | 3300042612 | Bacteria | 7599 |
| 24 | Ga0466700_390977 | 3300042600 | Bacteria | 2002 |
| 25 | Ga0466707_275107 | 3300042601 | Bacteria | 4768 |
| 26 | Ga0123353_10328129 | 3300010167 | Bacteria | 2318 |
| 27 | Ga0123353_10383681 | 3300010167 | Bacteria | 2100 |
| 28 | JGI24702J35022_10071348 | 3300002462 | Bacteria | 1871 |
| 29 | Ga0466735_102058 | 3300042624 | Bacteria | 1781 |
| 30 | Ga0466703_190191 | 3300042636 | Bacteria | 16702 |
| 31 | Ga0466709_381365 | 3300042648 | Bacteria | 28038 |
| 32 | Ga0466708_306716 | 3300042652 | Bacteria | 4601 |
| 33 | Ga0466727_085455 | 3300042655 | Bacteria | 8904 |
| 34 | Ga0415639_127012 | 3300038395 | Bacteria | 2253 |
| 35 | Ga0466694_200014 | 3300042594 | Bacteria | 3065 |
| 36 | Ga0466699_097650 | 3300042597 | Bacteria | 13304 |
| 37 | Ga0466699_119784 | 3300042597 | Bacteria | 1603 |
| 38 | Ga0466699_361759 | 3300042597 | Bacteria | 17909 |
| 39 | Ga0466711_231842 | 3300042615 | Bacteria | 4590 |
| 40 | Ga0466705_192788 | 3300042612 | Bacteria | 9605 |
| 41 | Ga0466732_357098 | 3300042656 | Bacteria | 1190 |
| 42 | Ga0466716_083926 | 3300042605 | Bacteria | 4388 |
| 43 | Ga0466716_103489 | 3300042605 | Bacteria | 23373 |
| 44 | Ga0466716_413272 | 3300042605 | Bacteria | 4844 |
| 45 | Ga0466719_086365 | 3300042606 | Bacteria | 3841 |
| 46 | Ga0123353_10223737 | 3300010167 | Bacteria | 2940 |
| 47 | Ga0123353_10597638 | 3300010167 | Bacteria | 1578 |
| 48 | JGI24698J34947_10007384 | 3300002449 | Bacteria | 6043 |
| 49 | JGI24698J34947_10010492 | 3300002449 | Archaea | 5083 |
| 50 | JGI24698J34947_10014099 | 3300002449 | Bacteria | 4353 |
| 51 | JGI24695J34938_10044212 | 3300002450 | Bacteria | 1982 |
| 52 | Ga0072941_1069540 | 3300005201 | Bacteria | 7381 |
| 53 | Ga0466709_367347 | 3300042648 | Unclassified | 2426 |
| 54 | Ga0466708_066838 | 3300042652 | Bacteria | 32818 |
| 55 | Ga0466727_253302 | 3300042655 | Bacteria | 1046 |
| 56 | Ga0466692_176025 | 3300042591 | Bacteria | 5014 |
| 57 | Ga0466694_296704 | 3300042594 | Bacteria | 5111 |
| 58 | Ga0466699_221757 | 3300042597 | Bacteria | 6612 |
| 59 | Ga0466699_334237 | 3300042597 | Bacteria | 6679 |
| 60 | Ga0466712_056612 | 3300042614 | Bacteria | 4163 |
| 61 | Ga0466712_227820 | 3300042614 | Bacteria | 10918 |
| 62 | Ga0466715_119465 | 3300042616 | Bacteria | 1757 |
| 63 | Ga0466718_130940 | 3300042617 | Bacteria | 1009 |
| 64 | Ga0466732_457420 | 3300042656 | Bacteria | 16341 |
| 65 | Ga0466716_175916 | 3300042605 | Bacteria | 3969 |
| 66 | Ga0466719_312743 | 3300042606 | Bacteria | 3240 |
| 67 | Ga0466720_184394 | 3300042607 | Bacteria | 10545 |
| 68 | Ga0466722_238238 | 3300042609 | Bacteria | 2815 |
| 69 | Ga0466698_334691 | 3300042610 | Bacteria | 2341 |
| 70 | Ga0123353_10006277 | 3300010167 | Bacteria | 15798 |
| 71 | Ga0123353_10012036 | 3300010167 | Bacteria | 12248 |
| 72 | Ga0123354_10172284 | 3300010882 | Bacteria | 2512 |
| 73 | JGI24698J34947_10005168 | 3300002449 | Bacteria | 7157 |
| 74 | Ga0074263_120136 | 3300005485 | Bacteria | 859 |
| 75 | Ga0466703_195943 | 3300042636 | Unclassified | 4239 |
| 76 | Ga0466704_318617 | 3300042643 | Bacteria | 7972 |
| 77 | Ga0466704_514167 | 3300042643 | Bacteria | 27255 |
| 78 | Ga0466709_115850 | 3300042648 | Bacteria | 2988 |
| 79 | Ga0466727_198594 | 3300042655 | Bacteria | 4148 |
| 80 | Ga0264413_139685 | 3300024493 | Bacteria | 1742 |
| 81 | Ga0466691_023900 | 3300042593 | Bacteria | 8364 |
| 82 | Ga0466696_148227 | 3300042596 | Bacteria | 13278 |
| 83 | Ga0466712_068178 | 3300042614 | Bacteria | 3075 |
| 84 | Ga0466712_073360 | 3300042614 | Bacteria | 4878 |
| 85 | Ga0466712_113375 | 3300042614 | Bacteria | 2060 |
| 86 | Ga0466712_214687 | 3300042614 | Bacteria | 30580 |
| 87 | Ga0466715_073939 | 3300042616 | Bacteria | 8217 |
| 88 | Ga0466715_221116 | 3300042616 | Bacteria | 8435 |
| 89 | Ga0466718_038889 | 3300042617 | Bacteria | 1548 |
| 90 | Ga0466718_082611 | 3300042617 | Bacteria | 1616 |
| 91 | Ga0466723_079469 | 3300042618 | Bacteria | 8572 |
| 92 | Ga0466726_358252 | 3300042619 | Unclassified | 7226 |
| 93 | Ga0466728_135713 | 3300042620 | Bacteria | 4243 |
| 94 | Ga0466719_120968 | 3300042606 | Bacteria | 2004 |
| 95 | Ga0466719_525115 | 3300042606 | Bacteria | 18067 |
| 96 | Ga0466698_512698 | 3300042610 | Bacteria | 1254 |
| 97 | Ga0123357_10004062 | 3300009784 | Bacteria | 17044 |
| 98 | Ga0123357_10038970 | 3300009784 | Bacteria | 6472 |
| 99 | Ga0123356_10578536 | 3300010049 | Bacteria | 1286 |
| 100 | Ga0123353_10326388 | 3300010167 | Bacteria | 2326 |
| 101 | JGI24698J34947_10029400 | 3300002449 | Bacteria | 2902 |
| 102 | JGI24695J34938_10073354 | 3300002450 | Archaea | 1426 |
| 103 | Ga0466735_012746 | 3300042624 | Bacteria | 4599 |
| 104 | Ga0466735_137056 | 3300042624 | Bacteria | 11891 |
| 105 | Ga0466735_149126 | 3300042624 | Bacteria | 1286 |
| 106 | Ga0466727_195376 | 3300042655 | Unclassified | 1391 |
| 107 | Ga0466727_284388 | 3300042655 | Bacteria | 1208 |
| 108 | Ga0466692_085676 | 3300042591 | Bacteria | 1284 |
| 109 | Ga0466699_429931 | 3300042597 | Bacteria | 3993 |
| 110 | Ga0466715_022429 | 3300042616 | Bacteria | 7684 |
| 111 | Ga0466718_029073 | 3300042617 | Bacteria | 1031 |
| 112 | Ga0466728_426421 | 3300042620 | Bacteria | 1267 |
| 113 | Ga0466716_075825 | 3300042605 | Bacteria | 8410 |
| 114 | Ga0123353_10135821 | 3300010167 | Bacteria | 3944 |
| 115 | Ga0123353_10157333 | 3300010167 | Bacteria | 3621 |
| 116 | Ga0123354_10067995 | 3300010882 | Bacteria | 5183 |
| 117 | AustNasuHG_c1000256 | 3300000089 | Bacteria | 18107 |
| 118 | AustNasuHG_c1001596 | 3300000089 | Bacteria | 8166 |
| 119 | JGI24698J34947_10003741 | 3300002449 | Bacteria | 8283 |
| 120 | Ga0123357_10000236 | 3300009784 | Bacteria | 52499 |
| 121 | Ga0466734_159933 | 3300042623 | Bacteria | 1818 |
| 122 | Ga0466709_314975 | 3300042648 | Bacteria | 2121 |
| 123 | Ga0466699_084752 | 3300042597 | Bacteria | 4774 |
| 124 | Ga0466712_311738 | 3300042614 | Bacteria | 1898 |
| 125 | Ga0466711_502192 | 3300042615 | Bacteria | 57733 |
| 126 | Ga0466715_270505 | 3300042616 | Bacteria | 15014 |
| 127 | Ga0466723_203707 | 3300042618 | Bacteria | 10743 |
| 128 | Ga0466726_160402 | 3300042619 | Bacteria | 2926 |
| 129 | Ga0466726_190702 | 3300042619 | Bacteria | 17057 |
| 130 | Ga0466726_416871 | 3300042619 | Bacteria | 3928 |
| 131 | Ga0466728_102604 | 3300042620 | Bacteria | 28363 |
| 132 | Ga0466729_123406 | 3300042621 | Bacteria | 1288 |
| 133 | Ga0466732_179372 | 3300042656 | Bacteria | 2975 |
| 134 | Ga0466716_427118 | 3300042605 | Bacteria | 1780 |
| 135 | Ga0123357_10051684 | 3300009784 | Bacteria | 5554 |
| 136 | Ga0123353_10140851 | 3300010167 | Bacteria | 3863 |
| 137 | Ga0123354_10464536 | 3300010882 | Unclassified | 1014 |
| 138 | JGI24696J40584_12874506 | 3300002834 | Bacteria | 1059 |
| 139 | Ga0466731_310403 | 3300042622 | Bacteria | 3733 |
| 140 | Ga0466704_167297 | 3300042643 | Bacteria | 10385 |
| 141 | Ga0466692_095562 | 3300042591 | Unclassified | 3767 |
| 142 | Ga0466699_398670 | 3300042597 | Unclassified | 1171 |
| 143 | Ga0466712_026594 | 3300042614 | Bacteria | 12391 |
| 144 | Ga0466712_172552 | 3300042614 | Bacteria | 9789 |
| 145 | Ga0466715_004471 | 3300042616 | Bacteria | 12060 |
| 146 | Ga0466718_071044 | 3300042617 | Bacteria | 3278 |
| 147 | Ga0466723_060712 | 3300042618 | Bacteria | 6637 |
| 148 | Ga0466723_217117 | 3300042618 | Bacteria | 2821 |
| 149 | Ga0466723_304643 | 3300042618 | Bacteria | 4739 |
| 150 | Ga0466728_131051 | 3300042620 | Bacteria | 4473 |
| 151 | Ga0466716_371696 | 3300042605 | Bacteria | 8434 |
| 152 | Ga0466719_507586 | 3300042606 | Bacteria | 5240 |
| 153 | Ga0123357_10167771 | 3300009784 | Bacteria | 2608 |
| 154 | Ga0123355_10143342 | 3300009826 | Bacteria | 3649 |
| 155 | Ga0123353_10798744 | 3300010167 | Bacteria | 1303 |
| 156 | JGI24698J34947_10000985 | 3300002449 | Bacteria | 14587 |
| 157 | JGI24698J34947_10011046 | 3300002449 | Unclassified | 4954 |
| 158 | JGI24698J34947_10017604 | 3300002449 | Bacteria | 3870 |
| 159 | JGI24698J34947_10017696 | 3300002449 | Bacteria | 3859 |
| 160 | Ga0466703_048636 | 3300042636 | Bacteria | 8909 |
| 161 | Ga0466708_235665 | 3300042652 | Bacteria | 20578 |
| 162 | Ga0466727_097840 | 3300042655 | Bacteria | 3970 |
| 163 | Ga0466727_306967 | 3300042655 | Bacteria | 1281 |
| 164 | Ga0456237_0008327 | 3300041968 | Bacteria | 1569 |
| 165 | Ga0456237_0011410 | 3300041968 | Bacteria | 1297 |
| 166 | Ga0466694_237389 | 3300042594 | Bacteria | 2112 |
| 167 | Ga0466705_435365 | 3300042612 | Bacteria | 1856 |
| 168 | Ga0466711_044432 | 3300042615 | Bacteria | 9562 |
| 169 | Ga0466711_072495 | 3300042615 | Bacteria | 9574 |
| 170 | Ga0466718_066623 | 3300042617 | Bacteria | 7173 |
| 171 | Ga0466723_142946 | 3300042618 | Bacteria | 6319 |
| 172 | Ga0466726_041357 | 3300042619 | Bacteria | 6007 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01784 | DUF34_NIF3 | Duf34/NIF3 (NGG1p interacting factor 3) | 66 | 284 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.