Protein Family IF00467
Metagenome
Isolate
127
Members
56
Samples
118
Scaffolds
214.96
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10000244|JGI24698J34947_1000024411
- Length
- 257 aa
- Sequence
- MAGYRKDADIQRVRYSNTSFLNDKFPEEFTTNHTNNESRTKGTSLWLNNVRISSKAFVIFFFALFATLPALPVDAYIVTYKEQYYRLFHMHYNQYPDDTMENIYWLEHALKADFCNPLYALALIENETQWEKYRYLFMMHINIKLAEQHLFLGNKWNKRNAYFYNAPWKEQNLDSIKTAETCFRTALYYWQEALTWMEKAQDKRFRWINLQKVQFWEDEVARIEKKTLDYGKTINRELTLLQQVREKFEAMDENTY*
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.6%
Unclassified
22.2%
Kalotermitidae
22.2%
Rhinotermitidae
7.4%
Termopsidae
5.6%
Taxonomy
Archaea
1
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 35 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 53 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_339448 | 3300042606 | Bacteria | 5971 |
| 2 | Ga0466732_193606 | 3300042656 | Bacteria | 2382 |
| 3 | Ga0456237_0002006 | 3300041968 | Bacteria | 3292 |
| 4 | Ga0466692_168795 | 3300042591 | Bacteria | 10201 |
| 5 | JGI24698J34947_10007487 | 3300002449 | Bacteria | 5999 |
| 6 | JGI24695J34938_10007131 | 3300002450 | Bacteria | 6602 |
| 7 | JGI24697J35500_11274391 | 3300002507 | Bacteria | 7180 |
| 8 | Ga0068305_10040075 | 3300005083 | Bacteria | 13050 |
| 9 | Ga0466718_016778 | 3300042617 | Bacteria | 6052 |
| 10 | Ga0466723_264170 | 3300042618 | Bacteria | 1847 |
| 11 | Ga0466734_172301 | 3300042623 | Bacteria | 1599 |
| 12 | Ga0466703_080147 | 3300042636 | Bacteria | 13387 |
| 13 | Ga0466708_458404 | 3300042652 | Bacteria | 1828 |
| 14 | Ga0466707_312379 | 3300042601 | Bacteria | 2125 |
| 15 | Ga0466713_076536 | 3300042602 | Bacteria | 4422 |
| 16 | Ga0466720_091174 | 3300042607 | Bacteria | 1020 |
| 17 | Ga0466721_044270 | 3300042608 | Bacteria | 61345 |
| 18 | Ga0466699_352081 | 3300042597 | Bacteria | 1003 |
| 19 | Ga0123357_10009256 | 3300009784 | Bacteria | 12411 |
| 20 | Ga0123353_10153173 | 3300010167 | Bacteria | 3678 |
| 21 | JGI24698J34947_10004859 | 3300002449 | Bacteria | 7359 |
| 22 | JGI24698J34947_10033902 | 3300002449 | Bacteria | 2675 |
| 23 | JGI24695J34938_10002080 | 3300002450 | Bacteria | 15709 |
| 24 | JGI24699J35502_11059558 | 3300002509 | Bacteria | 1726 |
| 25 | Ga0072941_1001014 | 3300005201 | Bacteria | 35346 |
| 26 | Ga0074263_105427 | 3300005485 | Bacteria | 1390 |
| 27 | Ga0466712_132570 | 3300042614 | Bacteria | 32439 |
| 28 | Ga0466712_211962 | 3300042614 | Bacteria | 1245 |
| 29 | Ga0466712_292881 | 3300042614 | Bacteria | 1637 |
| 30 | Ga0466715_298491 | 3300042616 | Bacteria | 13335 |
| 31 | Ga0466726_030919 | 3300042619 | Bacteria | 1918 |
| 32 | Ga0466698_263040 | 3300042610 | Bacteria | 1878 |
| 33 | Ga0456237_0022634 | 3300041968 | Bacteria | 864 |
| 34 | Ga0466696_144526 | 3300042596 | Bacteria | 6911 |
| 35 | Ga0466699_114980 | 3300042597 | Bacteria | 29933 |
| 36 | AustNasuHG_c1011327 | 3300000089 | Bacteria | 3092 |
| 37 | JGI24698J34947_10004190 | 3300002449 | Unclassified | 7838 |
| 38 | JGI24698J34947_10020921 | 3300002449 | Unclassified | 3522 |
| 39 | JGI24698J34947_10057577 | 3300002449 | Bacteria | 1927 |
| 40 | Ga0466715_187595 | 3300042616 | Bacteria | 1063 |
| 41 | Ga0466729_280821 | 3300042621 | Bacteria | 1067 |
| 42 | Ga0466731_097390 | 3300042622 | Bacteria | 1448 |
| 43 | Ga0466719_420454 | 3300042606 | Bacteria | 7515 |
| 44 | Ga0466720_029809 | 3300042607 | Bacteria | 15349 |
| 45 | Ga0466694_093765 | 3300042594 | Bacteria | 40261 |
| 46 | Ga0466699_067965 | 3300042597 | Bacteria | 3126 |
| 47 | Ga0466699_258803 | 3300042597 | Bacteria | 1128 |
| 48 | Ga0123356_10012893 | 3300010049 | Bacteria | 8090 |
| 49 | JGI24698J34947_10036035 | 3300002449 | Bacteria | 2578 |
| 50 | JGI24695J34938_10029094 | 3300002450 | Bacteria | 2588 |
| 51 | JGI24705J35276_12214715 | 3300002504 | Bacteria | 1972 |
| 52 | Ga0123357_10000397 | 3300009784 | Bacteria | 41367 |
| 53 | Ga0466712_198988 | 3300042614 | Bacteria | 11374 |
| 54 | Ga0466712_227559 | 3300042614 | Bacteria | 24106 |
| 55 | Ga0466711_180490 | 3300042615 | Bacteria | 2635 |
| 56 | Ga0466718_011328 | 3300042617 | Bacteria | 10621 |
| 57 | Ga0466735_057320 | 3300042624 | Bacteria | 3353 |
| 58 | Ga0466704_062317 | 3300042643 | Bacteria | 7430 |
| 59 | Ga0466709_356630 | 3300042648 | Bacteria | 1375 |
| 60 | Ga0264413_120077 | 3300024493 | Bacteria | 1650 |
| 61 | Ga0466691_031623 | 3300042593 | Bacteria | 7269 |
| 62 | Ga0466694_029068 | 3300042594 | Bacteria | 2305 |
| 63 | Ga0466694_164189 | 3300042594 | Bacteria | 4946 |
| 64 | Ga0466699_009139 | 3300042597 | Bacteria | 17874 |
| 65 | Ga0466699_109749 | 3300042597 | Bacteria | 1457 |
| 66 | Ga0466699_172944 | 3300042597 | Bacteria | 1905 |
| 67 | Ga0466699_250612 | 3300042597 | Bacteria | 1995 |
| 68 | Ga0123357_10304805 | 3300009784 | Bacteria | 1602 |
| 69 | JGI24698J34947_10040949 | 3300002449 | Bacteria | 2389 |
| 70 | Ga0466712_138486 | 3300042614 | Bacteria | 11308 |
| 71 | Ga0466712_255107 | 3300042614 | Bacteria | 6049 |
| 72 | Ga0466712_298148 | 3300042614 | Bacteria | 4016 |
| 73 | Ga0466718_128348 | 3300042617 | Bacteria | 4851 |
| 74 | Ga0466728_242451 | 3300042620 | Bacteria | 19043 |
| 75 | Ga0466731_076470 | 3300042622 | Bacteria | 1525 |
| 76 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 77 | Ga0466727_057291 | 3300042655 | Bacteria | 1994 |
| 78 | Ga0466707_398347 | 3300042601 | Bacteria | 1440 |
| 79 | Ga0466720_038699 | 3300042607 | Unclassified | 2535 |
| 80 | Ga0466722_093242 | 3300042609 | Bacteria | 11108 |
| 81 | Ga0466691_211751 | 3300042593 | Bacteria | 5645 |
| 82 | Ga0466694_409225 | 3300042594 | Bacteria | 36264 |
| 83 | Ga0123355_10003512 | 3300009826 | Bacteria | 22505 |
| 84 | Ga0123356_10005618 | 3300010049 | Bacteria | 12745 |
| 85 | Ga0123356_10679956 | 3300010049 | Bacteria | 1197 |
| 86 | JGI24698J34947_10000573 | 3300002449 | Bacteria | 17535 |
| 87 | JGI24698J34947_10000829 | 3300002449 | Bacteria | 15470 |
| 88 | JGI24698J34947_10070631 | 3300002449 | Bacteria | 1680 |
| 89 | Ga0466712_021999 | 3300042614 | Bacteria | 31719 |
| 90 | Ga0466712_031245 | 3300042614 | Bacteria | 6887 |
| 91 | Ga0466718_104406 | 3300042617 | Bacteria | 4561 |
| 92 | Ga0466705_035843 | 3300042612 | Bacteria | 27929 |
| 93 | Ga0466707_158784 | 3300042601 | Bacteria | 1007 |
| 94 | Ga0264413_125221 | 3300024493 | Bacteria | 11706 |
| 95 | Ga0466699_317071 | 3300042597 | Archaea | 6577 |
| 96 | JGI24698J34947_10000244 | 3300002449 | Bacteria | 22726 |
| 97 | JGI24695J34938_10009531 | 3300002450 | Unclassified | 5392 |
| 98 | Ga0466715_520515 | 3300042616 | Bacteria | 12928 |
| 99 | Ga0466726_172358 | 3300042619 | Bacteria | 17260 |
| 100 | Ga0466728_250490 | 3300042620 | Bacteria | 2685 |
| 101 | Ga0466727_285370 | 3300042655 | Bacteria | 1689 |
| 102 | Ga0466727_292803 | 3300042655 | Bacteria | 4286 |
| 103 | Ga0466700_384293 | 3300042600 | Bacteria | 1523 |
| 104 | Ga0466720_039047 | 3300042607 | Bacteria | 3537 |
| 105 | Ga0466720_102376 | 3300042607 | Bacteria | 3961 |
| 106 | Ga0466733_084000 | 3300042659 | Bacteria | 2526 |
| 107 | Ga0264413_100875 | 3300024493 | Bacteria | 63331 |
| 108 | Ga0264413_112282 | 3300024493 | Bacteria | 20923 |
| 109 | Ga0466694_146239 | 3300042594 | Bacteria | 3647 |
| 110 | Ga0123357_10049803 | 3300009784 | Bacteria | 5673 |
| 111 | Ga0123356_10622761 | 3300010049 | Bacteria | 1245 |
| 112 | JGI24698J34947_10051102 | 3300002449 | Unclassified | 2081 |
| 113 | Ga0072941_1026610 | 3300005201 | Bacteria | 19352 |
| 114 | Ga0466712_016304 | 3300042614 | Bacteria | 11968 |
| 115 | Ga0466712_091130 | 3300042614 | Bacteria | 23740 |
| 116 | Ga0466712_165234 | 3300042614 | Bacteria | 4696 |
| 117 | Ga0466715_447524 | 3300042616 | Bacteria | 20272 |
| 118 | Ga0466727_312409 | 3300042655 | Bacteria | 1549 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.