Protein Family IF00465

Metagenome Isolate
162 Members
57 Samples
149 Scaffolds
457.14 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10000228|JGI24698J34947_100002282
Length
513 aa
Sequence
LWNLCFFVSIDMFYWLVLVLSIRVEYWVNPRYWRPGFLSAILPIVKKQKTFVFRCSSCGHEEPKWLGRCPECGEWNTLIETSISGNRGVNQGKRSAEAPPQSMPLSTVDPLEGTRIKSGIDELDRVLGGGIMKRSAILVGGEPGIGKSTLLLQTAAAAGTKGRVLYVTGEESAGQVKMRADRLGVSGDRIEIFCSGNLQEIQPIIEALKPVLIMIDSAQTLFSTEAGSTPGTVNQMKYCSWELISWIKEHDSALFLTAHVTKDGFISGPKSLEHMVDTVLYFEDSAQTANNGDTRFLRAVKNRFGSVDEIGIFTMGEKGLSAVEDPSLLFLVRREGDLPPGIATAAVLEGSRTLLVEIQALTVPAKGSISRVFSDRIDSARVSRVAAVIEKHLGLRLSDQDLYINIAGGIRIAEVGVELALACALYSARTGVPVPAKTAIAGELSLAGEVRPLRRLPIRVKTARNLGFTEFLGPASSAGAAVEAGAEAMPTEGFFAFRNIREAVKAVFSVKV*

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.9%
Unclassified 29.1%
Kalotermitidae 25.5%
Rhinotermitidae 7.3%
Termopsidae 5.5%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
11 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
12 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
13 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
22 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
28 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
29 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
39 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
42 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
43 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
44 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
54 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
55 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
56 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
57 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_131691 3300042590 Bacteria 32508
2 Ga0466695_121101 3300042595 Bacteria 6620
3 Ga0466696_256809 3300042596 Bacteria 1567
4 Ga0123356_10000299 3300010049 Bacteria 57073
5 Ga0068305_10040429 3300005083 Bacteria 22658
6 Ga0072941_1002416 3300005201 Unclassified 6298
7 Ga0123357_10002380 3300009784 Bacteria 20942
8 Ga0466712_265968 3300042614 Unclassified 14233
9 Ga0466715_315390 3300042616 Bacteria 5290
10 Ga0466718_127016 3300042617 Bacteria 2663
11 Ga0466726_257251 3300042619 Bacteria 17671
12 Ga0466729_196442 3300042621 Bacteria 4923
13 Ga0466735_005070 3300042624 Bacteria 2049
14 Ga0466708_048008 3300042652 Bacteria 9513
15 Ga0466708_186978 3300042652 Bacteria 16520
16 Ga0466706_287397 3300042599 Bacteria 2685
17 Ga0466716_194855 3300042605 Bacteria 9681
18 Ga0415639_011990 3300038395 Bacteria 15522
19 Ga0466690_125906 3300042590 Bacteria 4285
20 Ga0466690_335423 3300042590 Bacteria 3593
21 Ga0466699_007354 3300042597 Bacteria 15094
22 Ga0123353_10424580 3300010167 Bacteria 1968
23 AustNasuHG_c1002424 3300000089 Bacteria 6736
24 JGI24698J34947_10000228 3300002449 Bacteria 23201
25 JGI24698J34947_10003600 3300002449 Bacteria 8414
26 JGI24698J34947_10006626 3300002449 Unclassified 6362
27 JGI24695J34938_10000339 3300002450 Bacteria 46161
28 Ga0068305_10031381 3300005083 Unclassified 5224
29 Ga0466711_410308 3300042615 Bacteria 7589
30 Ga0466723_234195 3300042618 Bacteria 3733
31 Ga0466728_064424 3300042620 Bacteria 3885
32 Ga0466703_270977 3300042636 Bacteria 5269
33 Ga0466704_151413 3300042643 Bacteria 12514
34 Ga0466709_268114 3300042648 Bacteria 29907
35 Ga0466707_259536 3300042601 Bacteria 2023
36 Ga0466713_017301 3300042602 Bacteria 11158
37 Ga0466716_093597 3300042605 Bacteria 3941
38 Ga0466716_157008 3300042605 Bacteria 1833
39 Ga0456237_0003335 3300041968 Bacteria 2606
40 Ga0466690_215198 3300042590 Bacteria 2267
41 Ga0466695_217089 3300042595 Bacteria 2435
42 Ga0466696_110214 3300042596 Bacteria 5353
43 Ga0466699_345901 3300042597 Bacteria 6095
44 Ga0123355_10415997 3300009826 Bacteria 1722
45 JGI24698J34947_10000599 3300002449 Bacteria 17242
46 JGI24698J34947_10009139 3300002449 Bacteria 5437
47 Ga0466705_022934 3300042612 Bacteria 6801
48 Ga0466715_156533 3300042616 Bacteria 9385
49 Ga0466718_034807 3300042617 Bacteria 3794
50 Ga0466723_200749 3300042618 Bacteria 72306
51 Ga0466726_160164 3300042619 Bacteria 1964
52 Ga0466729_012776 3300042621 Bacteria 4274
53 Ga0466729_235441 3300042621 Bacteria 2408
54 Ga0466703_100612 3300042636 Bacteria 66039
55 Ga0466709_077961 3300042648 Bacteria 2321
56 Ga0466727_010715 3300042655 Bacteria 1822
57 Ga0466706_091635 3300042599 Bacteria 2697
58 Ga0466713_041035 3300042602 Bacteria 22462
59 Ga0466719_050778 3300042606 Bacteria 24110
60 Ga0466720_218407 3300042607 Bacteria 1616
61 Ga0466722_234349 3300042609 Bacteria 6590
62 Ga0264413_105092 3300024493 Bacteria 2086
63 Ga0466690_229942 3300042590 Bacteria 13697
64 Ga0466691_207329 3300042593 Bacteria 5395
65 Ga0466694_279878 3300042594 Bacteria 3512
66 Ga0466699_175508 3300042597 Bacteria 18938
67 Ga0123356_10000063 3300010049 Bacteria 111723
68 JGI24695J34938_10000429 3300002450 Bacteria 40528
69 Ga0072941_1000180 3300005201 Bacteria 54954
70 Ga0466712_111653 3300042614 Unclassified 2465
71 Ga0466711_196122 3300042615 Bacteria 16619
72 Ga0466711_484865 3300042615 Bacteria 4088
73 Ga0466715_016482 3300042616 Bacteria 19232
74 Ga0466715_487341 3300042616 Bacteria 37758
75 Ga0466723_028525 3300042618 Bacteria 8291
76 Ga0466723_167234 3300042618 Unclassified 5133
77 Ga0466735_204709 3300042624 Bacteria 1649
78 Ga0466703_191246 3300042636 Bacteria 6355
79 Ga0466709_387536 3300042648 Bacteria 11594
80 Ga0466708_054951 3300042652 Bacteria 12911
81 Ga0466708_298842 3300042652 Bacteria 10039
82 Ga0466713_047218 3300042602 Bacteria 6203
83 Ga0466717_266080 3300042604 Bacteria 3291
84 Ga0466716_298563 3300042605 Bacteria 1667
85 Ga0466719_503398 3300042606 Bacteria 1898
86 Ga0466691_092215 3300042593 Bacteria 4860
87 Ga0466691_145543 3300042593 Bacteria 12166
88 Ga0123356_10003502 3300010049 Bacteria 16427
89 Ga0072941_1004758 3300005201 Bacteria 15451
90 Ga0466715_201539 3300042616 Bacteria 4080
91 Ga0466715_373815 3300042616 Bacteria 7242
92 Ga0466723_111695 3300042618 Bacteria 17779
93 Ga0466723_178668 3300042618 Bacteria 30352
94 Ga0466723_225377 3300042618 Bacteria 3660
95 Ga0466726_089562 3300042619 Bacteria 2336
96 Ga0466726_103471 3300042619 Bacteria 1888
97 Ga0466726_198371 3300042619 Bacteria 1870
98 Ga0466726_371729 3300042619 Bacteria 5444
99 Ga0466735_057159 3300042624 Bacteria 4426
100 Ga0466708_086441 3300042652 Bacteria 5223
101 Ga0466716_316599 3300042605 Bacteria 6560
102 Ga0466719_516124 3300042606 Bacteria 2135
103 Ga0466694_066336 3300042594 Bacteria 9198
104 Ga0123357_10190733 3300009784 Bacteria 2362
105 Ga0123355_10012757 3300009826 Bacteria 13031
106 Ga0466705_134115 3300042612 Bacteria 13835
107 Ga0466715_090509 3300042616 Bacteria 2175
108 Ga0466726_332717 3300042619 Bacteria 8555
109 Ga0466729_200625 3300042621 Bacteria 1726
110 Ga0466703_357216 3300042636 Bacteria 7322
111 Ga0466704_415790 3300042643 Bacteria 9920
112 Ga0466719_535255 3300042606 Bacteria 28946
113 Ga0264413_108850 3300024493 Bacteria 5307
114 Ga0466692_152387 3300042591 Bacteria 29225
115 Ga0466693_328961 3300042592 Bacteria 11085
116 Ga0466691_138447 3300042593 Bacteria 5698
117 Ga0466694_156129 3300042594 Bacteria 74614
118 Ga0466694_158877 3300042594 Bacteria 17130
119 Ga0466696_110638 3300042596 Bacteria 39746
120 Ga0466696_113081 3300042596 Bacteria 3462
121 Ga0466696_328932 3300042596 Bacteria 6273
122 Ga0466699_341963 3300042597 Unclassified 1364
123 Ga0466699_393350 3300042597 Bacteria 5651
124 Ga0123356_10131055 3300010049 Bacteria 2457
125 Ga0123353_10228450 3300010167 Bacteria 2904
126 Ga0123353_10541553 3300010167 Bacteria 1682
127 JGI24695J34938_10007080 3300002450 Bacteria 6633
128 Ga0466705_050869 3300042612 Bacteria 37849
129 Ga0466723_167395 3300042618 Bacteria 3870
130 Ga0466709_106710 3300042648 Bacteria 6239
131 Ga0466708_023289 3300042652 Bacteria 34585
132 Ga0466708_065397 3300042652 Bacteria 17220
133 Ga0466708_088485 3300042652 Bacteria 6997
134 Ga0466708_196954 3300042652 Unclassified 1609
135 Ga0466708_268643 3300042652 Bacteria 13669
136 Ga0466708_402467 3300042652 Bacteria 7049
137 Ga0466700_092661 3300042600 Bacteria 2959
138 Ga0466692_016827 3300042591 Bacteria 9713
139 Ga0466692_105569 3300042591 Bacteria 2034
140 Ga0466691_032182 3300042593 Bacteria 10851
141 Ga0466691_056863 3300042593 Bacteria 29448
142 Ga0123356_10008920 3300010049 Bacteria 9927
143 Ga0466711_099713 3300042615 Bacteria 7714
144 Ga0466718_156290 3300042617 Bacteria 3055
145 Ga0466704_024494 3300042643 Bacteria 5660
146 Ga0466708_183502 3300042652 Bacteria 5984
147 Ga0466716_257433 3300042605 Bacteria 7922
148 Ga0466719_037614 3300042606 Bacteria 10591
149 Ga0466720_106412 3300042607 Bacteria 2736

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18073 Rubredoxin_2 Rubredoxin metal binding domain 53 80 0.97
PF13541 ChlI Subunit ChlI of Mg-chelatase 383 475 0.93
PF06745 ATPase KaiC 116 189 0.9
PF13481 AAA_25 AAA domain 114 264 0.82
PF03796 DnaB_C DnaB-like helicase C terminal domain 116 218 0.76

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.