Protein Family IF00297
Metagenome
Isolate
207
Members
54
Samples
197
Scaffolds
376.14
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1027955|AustNasuHG_10279551
- Length
- 410 aa
- Sequence
- MLISNYLFLLYYLYGEENDFYCTVNNYLHFVYQFGSARFTAGSAWPSMYGGXKVPLHYAGYVSMIIAGGTVISSIFSEKIIRRFGTGLVTSFSVFMTAAALLGFSFSPSFALLCLFAVPLGLGAGSVDAALNNYVALNYKAKHMSWLXCFWGVGASMGPVIMSFFLINRNSWNLGYRAIGLLQCGLVAVLFXTISLWGKNKSQNGNEKNEASQGIKFKELFHIAGVKQILIAFFCYCSLETTTGLWGSSYLVMERNISPEIAARWISLYYLGITAGRFISGFLTMKLTNRQMVRLGQCLIALGIVALLLPADRIFLLPGFFIIGLGCAPIYPSLLHETPRNFGSEKSQAIMGIQMASAYIGTTFMPPLFGKLTSFFSFNLFPLFIGCILLLNIVMVEILNKKVDKNKVS*
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Kalotermitidae
27.5%
Unclassified
15.7%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Blaberidae
2.0%
Stratiomyidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 2 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 3 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 4 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 5 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 20 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 35 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 36 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_152703 | 3300042656 | Bacteria | 7013 |
| 2 | Ga0123356_10000279 | 3300010049 | Bacteria | 58981 |
| 3 | Ga0264413_118770 | 3300024493 | Bacteria | 8171 |
| 4 | AustNasuHG_c1001623 | 3300000089 | Bacteria | 8107 |
| 5 | AustNasuHG_c1017090 | 3300000089 | Unclassified | 2417 |
| 6 | JGI24698J34947_10053082 | 3300002449 | Bacteria | 2031 |
| 7 | Ga0466735_119626 | 3300042624 | Bacteria | 2263 |
| 8 | Ga0466707_343869 | 3300042601 | Bacteria | 1913 |
| 9 | Ga0466714_022997 | 3300042603 | Bacteria | 2366 |
| 10 | Ga0466714_026375 | 3300042603 | Bacteria | 121146 |
| 11 | Ga0466716_141012 | 3300042605 | Bacteria | 8382 |
| 12 | Ga0466720_059835 | 3300042607 | Bacteria | 2194 |
| 13 | Ga0466722_186491 | 3300042609 | Bacteria | 10171 |
| 14 | Ga0466718_008834 | 3300042617 | Bacteria | 9423 |
| 15 | Ga0466723_080747 | 3300042618 | Bacteria | 2250 |
| 16 | Ga0466728_474298 | 3300042620 | Bacteria | 45956 |
| 17 | Ga0466729_072855 | 3300042621 | Bacteria | 1428 |
| 18 | Ga0466732_250353 | 3300042656 | Bacteria | 2678 |
| 19 | Ga0466732_395984 | 3300042656 | Bacteria | 4871 |
| 20 | Ga0123356_10178691 | 3300010049 | Bacteria | 2142 |
| 21 | Ga0466691_132386 | 3300042593 | Bacteria | 5421 |
| 22 | AustNasuHG_c1001256 | 3300000089 | Bacteria | 9137 |
| 23 | JGI24698J34947_10022765 | 3300002449 | Bacteria | 3356 |
| 24 | JGI24695J34938_10003776 | 3300002450 | Bacteria | 10320 |
| 25 | JGI24695J34938_10006393 | 3300002450 | Bacteria | 7090 |
| 26 | JGI24695J34938_10011043 | 3300002450 | Bacteria | 4897 |
| 27 | Ga0074263_112484 | 3300005485 | Unclassified | 2134 |
| 28 | Ga0466704_042456 | 3300042643 | Bacteria | 19892 |
| 29 | Ga0466708_304523 | 3300042652 | Bacteria | 11652 |
| 30 | Ga0466720_104816 | 3300042607 | Bacteria | 4616 |
| 31 | Ga0466722_050362 | 3300042609 | Bacteria | 2343 |
| 32 | Ga0466712_030500 | 3300042614 | Bacteria | 8377 |
| 33 | Ga0466711_368334 | 3300042615 | Bacteria | 2661 |
| 34 | Ga0466718_143429 | 3300042617 | Bacteria | 2200 |
| 35 | Ga0466723_252439 | 3300042618 | Bacteria | 2305 |
| 36 | Ga0466728_271542 | 3300042620 | Bacteria | 13311 |
| 37 | Ga0466705_067609 | 3300042612 | Bacteria | 5333 |
| 38 | Ga0466705_329611 | 3300042612 | Bacteria | 6753 |
| 39 | Ga0466732_267875 | 3300042656 | Bacteria | 2596 |
| 40 | Ga0466694_011295 | 3300042594 | Bacteria | 21289 |
| 41 | Ga0466699_133032 | 3300042597 | Bacteria | 4974 |
| 42 | Ga0466699_151803 | 3300042597 | Bacteria | 2431 |
| 43 | Ga0466699_322115 | 3300042597 | Bacteria | 17081 |
| 44 | Ga0466699_340436 | 3300042597 | Bacteria | 2167 |
| 45 | JGI24698J34947_10044268 | 3300002449 | Bacteria | 2279 |
| 46 | Ga0072941_1046806 | 3300005201 | Bacteria | 7283 |
| 47 | Ga0466704_190785 | 3300042643 | Bacteria | 8585 |
| 48 | Ga0466727_142330 | 3300042655 | Bacteria | 1447 |
| 49 | Ga0466716_068278 | 3300042605 | Bacteria | 2299 |
| 50 | Ga0466720_043777 | 3300042607 | Bacteria | 12615 |
| 51 | Ga0466720_105179 | 3300042607 | Bacteria | 9700 |
| 52 | Ga0466712_008224 | 3300042614 | Bacteria | 21748 |
| 53 | Ga0466711_411375 | 3300042615 | Bacteria | 19214 |
| 54 | Ga0466718_022527 | 3300042617 | Bacteria | 15487 |
| 55 | Ga0466718_033626 | 3300042617 | Bacteria | 2653 |
| 56 | Ga0466723_009823 | 3300042618 | Bacteria | 1919 |
| 57 | Ga0466729_152513 | 3300042621 | Bacteria | 3226 |
| 58 | Ga0466705_023684 | 3300042612 | Bacteria | 7396 |
| 59 | Ga0466732_214763 | 3300042656 | Bacteria | 5186 |
| 60 | Ga0466732_224535 | 3300042656 | Bacteria | 6213 |
| 61 | Ga0264413_119760 | 3300024493 | Bacteria | 2217 |
| 62 | Ga0466693_050375 | 3300042592 | Bacteria | 4478 |
| 63 | Ga0466694_115989 | 3300042594 | Bacteria | 50409 |
| 64 | Ga0466694_155869 | 3300042594 | Bacteria | 1871 |
| 65 | Ga0466696_067802 | 3300042596 | Bacteria | 1414 |
| 66 | Ga0466699_183739 | 3300042597 | Bacteria | 1617 |
| 67 | AustNasuHG_c1012138 | 3300000089 | Bacteria | 2977 |
| 68 | FAAS_10006834 | 3300001880 | Bacteria | 1303 |
| 69 | JGI24698J34947_10039467 | 3300002449 | Bacteria | 2444 |
| 70 | JGI24696J40584_12958331 | 3300002834 | Unclassified | 4044 |
| 71 | Ga0466704_551452 | 3300042643 | Bacteria | 2009 |
| 72 | Ga0466708_170637 | 3300042652 | Bacteria | 1794 |
| 73 | Ga0466714_085829 | 3300042603 | Bacteria | 36662 |
| 74 | Ga0466719_159023 | 3300042606 | Bacteria | 20958 |
| 75 | Ga0466720_007766 | 3300042607 | Bacteria | 2143 |
| 76 | Ga0466711_119434 | 3300042615 | Bacteria | 8744 |
| 77 | Ga0466718_019652 | 3300042617 | Bacteria | 3770 |
| 78 | Ga0466718_078531 | 3300042617 | Bacteria | 4455 |
| 79 | Ga0466732_064626 | 3300042656 | Unclassified | 1442 |
| 80 | Ga0466733_187677 | 3300042659 | Bacteria | 1331 |
| 81 | Ga0123356_10005273 | 3300010049 | Bacteria | 13195 |
| 82 | Ga0123353_10158358 | 3300010167 | Bacteria | 3607 |
| 83 | Ga0415639_020558 | 3300038395 | Unclassified | 2306 |
| 84 | Ga0466692_079822 | 3300042591 | Bacteria | 2240 |
| 85 | Ga0466694_027859 | 3300042594 | Bacteria | 2231 |
| 86 | Ga0466694_239052 | 3300042594 | Bacteria | 1503 |
| 87 | Ga0466699_155472 | 3300042597 | Bacteria | 1440 |
| 88 | Ga0466699_306428 | 3300042597 | Unclassified | 1953 |
| 89 | 2230969792 | 2228664004 | Bacteria | 2580 |
| 90 | AustNasuHG_c1010156 | 3300000089 | Bacteria | 3286 |
| 91 | AustNasuHG_c1011278 | 3300000089 | Bacteria | 3099 |
| 92 | JGI24698J34947_10017659 | 3300002449 | Bacteria | 3863 |
| 93 | JGI24695J34938_10001477 | 3300002450 | Bacteria | 19874 |
| 94 | JGI24695J34938_10002467 | 3300002450 | Bacteria | 14120 |
| 95 | JGI24695J34938_10008280 | 3300002450 | Bacteria | 5944 |
| 96 | JGI24695J34938_10036900 | 3300002450 | Bacteria | 2225 |
| 97 | Ga0072941_1017852 | 3300005201 | Bacteria | 17952 |
| 98 | Ga0466702_190239 | 3300042635 | Bacteria | 1935 |
| 99 | Ga0466703_127157 | 3300042636 | Bacteria | 10329 |
| 100 | Ga0466703_330816 | 3300042636 | Bacteria | 7280 |
| 101 | Ga0466709_078873 | 3300042648 | Bacteria | 12296 |
| 102 | Ga0466720_169032 | 3300042607 | Bacteria | 23174 |
| 103 | Ga0466712_293443 | 3300042614 | Bacteria | 21258 |
| 104 | Ga0466718_029208 | 3300042617 | Bacteria | 8397 |
| 105 | Ga0466726_086688 | 3300042619 | Bacteria | 3107 |
| 106 | Ga0466726_431917 | 3300042619 | Bacteria | 1550 |
| 107 | Ga0466732_160386 | 3300042656 | Bacteria | 2782 |
| 108 | Ga0123356_10028934 | 3300010049 | Bacteria | 5193 |
| 109 | Ga0466691_029489 | 3300042593 | Bacteria | 5450 |
| 110 | Ga0466699_228897 | 3300042597 | Bacteria | 1228 |
| 111 | AustNasuHG_c1000196 | 3300000089 | Bacteria | 19966 |
| 112 | AustNasuHG_c1000270 | 3300000089 | Bacteria | 17765 |
| 113 | AustNasuHG_c1004972 | 3300000089 | Unclassified | 4757 |
| 114 | AustNasuHG_c1010677 | 3300000089 | Bacteria | 3195 |
| 115 | AustNasuHG_c1011440 | 3300000089 | Bacteria | 3076 |
| 116 | AustNasuHG_c1027955 | 3300000089 | Unclassified | 1701 |
| 117 | JGI24698J34947_10000452 | 3300002449 | Bacteria | 19069 |
| 118 | JGI24698J34947_10019296 | 3300002449 | Archaea | 3679 |
| 119 | JGI24695J34938_10002854 | 3300002450 | Bacteria | 12590 |
| 120 | JGI24695J34938_10078346 | 3300002450 | Unclassified | 1369 |
| 121 | Ga0072941_1004171 | 3300005201 | Bacteria | 25127 |
| 122 | Ga0466703_297509 | 3300042636 | Bacteria | 7810 |
| 123 | Ga0466704_034925 | 3300042643 | Bacteria | 6869 |
| 124 | Ga0466704_251826 | 3300042643 | Bacteria | 10669 |
| 125 | Ga0466704_388138 | 3300042643 | Bacteria | 2230 |
| 126 | Ga0466727_054275 | 3300042655 | Bacteria | 2086 |
| 127 | Ga0466706_247143 | 3300042599 | Bacteria | 3003 |
| 128 | Ga0466707_002580 | 3300042601 | Bacteria | 2341 |
| 129 | Ga0466707_372772 | 3300042601 | Bacteria | 3703 |
| 130 | Ga0466714_129629 | 3300042603 | Bacteria | 1312 |
| 131 | Ga0466720_021794 | 3300042607 | Bacteria | 2733 |
| 132 | Ga0466720_047633 | 3300042607 | Bacteria | 8446 |
| 133 | Ga0466722_148849 | 3300042609 | Bacteria | 3153 |
| 134 | Ga0466705_391489 | 3300042612 | Bacteria | 1869 |
| 135 | Ga0466712_007924 | 3300042614 | Bacteria | 10909 |
| 136 | Ga0466712_050027 | 3300042614 | Bacteria | 14247 |
| 137 | Ga0466712_288091 | 3300042614 | Bacteria | 1975 |
| 138 | Ga0466718_036577 | 3300042617 | Bacteria | 1704 |
| 139 | Ga0466726_296784 | 3300042619 | Bacteria | 1428 |
| 140 | Ga0466705_018947 | 3300042612 | Bacteria | 6397 |
| 141 | Ga0123356_10032522 | 3300010049 | Unclassified | 4879 |
| 142 | Ga0466690_204462 | 3300042590 | Bacteria | 3876 |
| 143 | Ga0466699_057259 | 3300042597 | Bacteria | 8142 |
| 144 | AustNasuHG_c1021206 | 3300000089 | Bacteria | 2106 |
| 145 | JGI24695J34938_10037791 | 3300002450 | Bacteria | 2191 |
| 146 | Ga0072941_1001870 | 3300005201 | Bacteria | 3365 |
| 147 | Ga0072941_1023285 | 3300005201 | Bacteria | 3301 |
| 148 | Ga0466702_071789 | 3300042635 | Bacteria | 2697 |
| 149 | Ga0466702_324505 | 3300042635 | Bacteria | 1094 |
| 150 | Ga0466703_196359 | 3300042636 | Bacteria | 9820 |
| 151 | Ga0466704_070467 | 3300042643 | Bacteria | 1606 |
| 152 | Ga0466704_098487 | 3300042643 | Bacteria | 9011 |
| 153 | Ga0466708_377744 | 3300042652 | Bacteria | 2111 |
| 154 | Ga0466720_037962 | 3300042607 | Bacteria | 7195 |
| 155 | Ga0466720_127806 | 3300042607 | Bacteria | 2943 |
| 156 | Ga0466720_140886 | 3300042607 | Bacteria | 2341 |
| 157 | Ga0466720_141345 | 3300042607 | Bacteria | 8839 |
| 158 | Ga0466712_135418 | 3300042614 | Unclassified | 2389 |
| 159 | Ga0466712_286620 | 3300042614 | Bacteria | 7111 |
| 160 | Ga0466718_001123 | 3300042617 | Bacteria | 2023 |
| 161 | Ga0466718_034145 | 3300042617 | Unclassified | 1732 |
| 162 | Ga0466718_063528 | 3300042617 | Bacteria | 34799 |
| 163 | Ga0466723_095605 | 3300042618 | Bacteria | 14842 |
| 164 | Ga0466726_014991 | 3300042619 | Bacteria | 18195 |
| 165 | Ga0466726_151277 | 3300042619 | Bacteria | 11833 |
| 166 | Ga0466705_212148 | 3300042612 | Bacteria | 1835 |
| 167 | Ga0466732_101986 | 3300042656 | Bacteria | 25064 |
| 168 | Ga0466732_344594 | 3300042656 | Bacteria | 8867 |
| 169 | Ga0123355_10313476 | 3300009826 | Bacteria | 2123 |
| 170 | Ga0123356_10031370 | 3300010049 | Bacteria | 4973 |
| 171 | Ga0123356_10130382 | 3300010049 | Bacteria | 2462 |
| 172 | Ga0466690_016723 | 3300042590 | Bacteria | 2217 |
| 173 | Ga0466692_173393 | 3300042591 | Bacteria | 2888 |
| 174 | Ga0466693_152876 | 3300042592 | Bacteria | 3441 |
| 175 | Ga0466696_320454 | 3300042596 | Bacteria | 1553 |
| 176 | AustNasuHG_c1003511 | 3300000089 | Bacteria | 5667 |
| 177 | AustNasuHG_c1006486 | 3300000089 | Bacteria | 4173 |
| 178 | JGI24698J34947_10000487 | 3300002449 | Bacteria | 18637 |
| 179 | JGI24698J34947_10021516 | 3300002449 | Bacteria | 3467 |
| 180 | Ga0072941_1023286 | 3300005201 | Bacteria | 7884 |
| 181 | Ga0466704_149831 | 3300042643 | Bacteria | 3953 |
| 182 | Ga0466709_313963 | 3300042648 | Bacteria | 1502 |
| 183 | Ga0466708_004611 | 3300042652 | Bacteria | 24859 |
| 184 | Ga0466707_402942 | 3300042601 | Bacteria | 2306 |
| 185 | Ga0466719_159766 | 3300042606 | Bacteria | 3610 |
| 186 | Ga0466719_302075 | 3300042606 | Bacteria | 69558 |
| 187 | Ga0466719_530751 | 3300042606 | Unclassified | 2457 |
| 188 | Ga0466720_025388 | 3300042607 | Bacteria | 6575 |
| 189 | Ga0466720_116740 | 3300042607 | Bacteria | 72912 |
| 190 | Ga0466720_166433 | 3300042607 | Bacteria | 2351 |
| 191 | Ga0466720_212249 | 3300042607 | Bacteria | 2389 |
| 192 | Ga0466720_212995 | 3300042607 | Bacteria | 4982 |
| 193 | Ga0466720_226038 | 3300042607 | Bacteria | 2942 |
| 194 | Ga0466705_500441 | 3300042612 | Unclassified | 2833 |
| 195 | Ga0466711_263240 | 3300042615 | Bacteria | 3455 |
| 196 | Ga0466718_092308 | 3300042617 | Bacteria | 8719 |
| 197 | Ga0466726_187383 | 3300042619 | Bacteria | 19163 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07690 | MFS_1 | Major Facilitator Superfamily | 230 | 396 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.