Protein Family IF00284
Metagenome
Isolate
242
Members
65
Samples
225
Scaffolds
363.64
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1004294|AustNasuHG_10042943
- Length
- 409 aa
- Sequence
- MDDLPILREKTGVHTQTALNLPKYIEKNPSYQHNITMSKIPVGILGATGMVGQMYTSLLVNHPWFEVKYVAASPRSAGKTYAQAVAGRRHLDGSAAAKTDWLTGVGELIVQDANDLSKALDARKAGKCDFVFSALEMGKDEIKALEEAYAAAGIPVVSNASAHRWTADVAMLIAEVNHHHTDLIPIQRKNRGWDKGFIVVKPNCSIQSYTTPLWALMQKGYEIKRLLVTTMQAVSGAGYPGVPSWDIIDNLVPYIGGEEEKSEMEPLKIFGSINQEGVLVNATEPKIGVHCNRVPVSDGHTACVSLEFGAKKPSIEEVKKIWAEFKALPQEEHFPSAPERPIIVREEADRPQPKKDRDADKAMAITVGRIRPCTVFDLRFVGLSHNTVRGAAGGGILSAELLKHKGFI*
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.2%
Kalotermitidae
21.9%
Blattidae
15.6%
Unclassified
15.6%
Rhinotermitidae
6.2%
Termopsidae
4.7%
Passalidae
1.6%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
2
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 2 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 13 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 14 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 24 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 25 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 26 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 27 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 34 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 49 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 56 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 57 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 64 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_013172 | 3300042593 | Bacteria | 11157 |
| 2 | Ga0466696_261919 | 3300042596 | Bacteria | 12385 |
| 3 | Ga0466699_044086 | 3300042597 | Bacteria | 9553 |
| 4 | Ga0466704_051542 | 3300042643 | Bacteria | 13374 |
| 5 | Ga0466704_063980 | 3300042643 | Bacteria | 4068 |
| 6 | Ga0466704_379995 | 3300042643 | Unclassified | 16409 |
| 7 | Ga0466711_087374 | 3300042615 | Bacteria | 3132 |
| 8 | Ga0466711_509814 | 3300042615 | Bacteria | 3523 |
| 9 | Ga0466715_150421 | 3300042616 | Bacteria | 6753 |
| 10 | Ga0466723_173837 | 3300042618 | Bacteria | 38157 |
| 11 | Ga0466723_254832 | 3300042618 | Bacteria | 8953 |
| 12 | Ga0466726_246536 | 3300042619 | Bacteria | 3140 |
| 13 | Ga0466706_135918 | 3300042599 | Bacteria | 7967 |
| 14 | Ga0466707_049754 | 3300042601 | Bacteria | 3982 |
| 15 | Ga0466707_117012 | 3300042601 | Bacteria | 4321 |
| 16 | Ga0466707_189233 | 3300042601 | Bacteria | 1690 |
| 17 | Ga0466719_150059 | 3300042606 | Bacteria | 20768 |
| 18 | JGI24698J34947_10027059 | 3300002449 | Bacteria | 3044 |
| 19 | JGI24695J34938_10015727 | 3300002450 | Bacteria | 3873 |
| 20 | Ga0123354_10074457 | 3300010882 | Bacteria | 4864 |
| 21 | Ga0562375_1803 | 3300056856 | Bacteria | 26741 |
| 22 | Ga0466690_009127 | 3300042590 | Bacteria | 6648 |
| 23 | Ga0466690_184731 | 3300042590 | Bacteria | 8122 |
| 24 | Ga0466696_019050 | 3300042596 | Bacteria | 1653 |
| 25 | Ga0466696_067513 | 3300042596 | Bacteria | 10508 |
| 26 | Ga0466696_457221 | 3300042596 | Bacteria | 2333 |
| 27 | Ga0466699_270035 | 3300042597 | Bacteria | 1078 |
| 28 | Ga0466705_053612 | 3300042612 | Bacteria | 4107 |
| 29 | Ga0466705_342725 | 3300042612 | Bacteria | 4712 |
| 30 | Ga0466703_068539 | 3300042636 | Bacteria | 6874 |
| 31 | Ga0466704_361173 | 3300042643 | Bacteria | 24999 |
| 32 | Ga0466704_469744 | 3300042643 | Bacteria | 50861 |
| 33 | Ga0466708_436669 | 3300042652 | Bacteria | 3528 |
| 34 | Ga0466725_012060 | 3300042654 | Bacteria | 2987 |
| 35 | Ga0466711_086902 | 3300042615 | Bacteria | 4756 |
| 36 | Ga0466715_099637 | 3300042616 | Bacteria | 16149 |
| 37 | Ga0466723_096299 | 3300042618 | Bacteria | 2077 |
| 38 | Ga0466723_196947 | 3300042618 | Bacteria | 3411 |
| 39 | Ga0466726_028938 | 3300042619 | Bacteria | 1596 |
| 40 | Ga0466726_330769 | 3300042619 | Bacteria | 1121 |
| 41 | Ga0466717_052919 | 3300042604 | Bacteria | 3070 |
| 42 | Ga0466716_224103 | 3300042605 | Archaea | 4268 |
| 43 | Ga0466716_273513 | 3300042605 | Bacteria | 5831 |
| 44 | Ga0466719_008091 | 3300042606 | Bacteria | 4819 |
| 45 | Ga0466719_156740 | 3300042606 | Bacteria | 21000 |
| 46 | Ga0466719_221593 | 3300042606 | Bacteria | 8967 |
| 47 | Ga0466722_133532 | 3300042609 | Bacteria | 14393 |
| 48 | Ga0466690_225781 | 3300042590 | Bacteria | 2877 |
| 49 | Ga0466694_283559 | 3300042594 | Bacteria | 2479 |
| 50 | Ga0466705_019210 | 3300042612 | Bacteria | 14899 |
| 51 | Ga0466705_022291 | 3300042612 | Bacteria | 1910 |
| 52 | Ga0466705_248707 | 3300042612 | Bacteria | 2215 |
| 53 | Ga0466705_305611 | 3300042612 | Unclassified | 3679 |
| 54 | Ga0466729_253678 | 3300042621 | Unclassified | 1792 |
| 55 | Ga0466702_082455 | 3300042635 | Bacteria | 5086 |
| 56 | Ga0466703_064579 | 3300042636 | Bacteria | 2509 |
| 57 | Ga0466709_061036 | 3300042648 | Bacteria | 13570 |
| 58 | Ga0466708_394409 | 3300042652 | Bacteria | 11863 |
| 59 | Ga0466723_359745 | 3300042618 | Bacteria | 6261 |
| 60 | Ga0466726_174645 | 3300042619 | Bacteria | 11511 |
| 61 | Ga0466726_488200 | 3300042619 | Bacteria | 4839 |
| 62 | Ga0466707_249775 | 3300042601 | Bacteria | 3086 |
| 63 | Ga0466713_036739 | 3300042602 | Bacteria | 5504 |
| 64 | Ga0466713_039582 | 3300042602 | Bacteria | 8835 |
| 65 | Ga0466713_086439 | 3300042602 | Unclassified | 51900 |
| 66 | Ga0466716_152780 | 3300042605 | Bacteria | 2707 |
| 67 | Ga0466719_304044 | 3300042606 | Bacteria | 13674 |
| 68 | Ga0466722_063319 | 3300042609 | Bacteria | 3959 |
| 69 | Ga0466722_093459 | 3300042609 | Bacteria | 37704 |
| 70 | Ga0466722_202606 | 3300042609 | Bacteria | 3298 |
| 71 | Ga0466722_267636 | 3300042609 | Bacteria | 6582 |
| 72 | 2227524629 | 2225789004 | Bacteria | 16952 |
| 73 | 2227632128 | 2225789004 | Bacteria | 2115 |
| 74 | Ga0123356_10255938 | 3300010049 | Bacteria | 1831 |
| 75 | Ga0466690_078054 | 3300042590 | Bacteria | 45776 |
| 76 | Ga0466690_201575 | 3300042590 | Unclassified | 3655 |
| 77 | Ga0466691_014406 | 3300042593 | Bacteria | 15400 |
| 78 | Ga0466691_116209 | 3300042593 | Bacteria | 16837 |
| 79 | Ga0466691_121254 | 3300042593 | Bacteria | 16039 |
| 80 | Ga0466696_076705 | 3300042596 | Bacteria | 14008 |
| 81 | Ga0466696_082732 | 3300042596 | Bacteria | 35201 |
| 82 | Ga0466696_298644 | 3300042596 | Bacteria | 4417 |
| 83 | Ga0466699_426044 | 3300042597 | Bacteria | 8698 |
| 84 | Ga0466704_154549 | 3300042643 | Bacteria | 24370 |
| 85 | Ga0466704_208438 | 3300042643 | Bacteria | 1392 |
| 86 | Ga0466708_013013 | 3300042652 | Bacteria | 5360 |
| 87 | Ga0466708_245403 | 3300042652 | Unclassified | 6298 |
| 88 | Ga0466708_315970 | 3300042652 | Bacteria | 4668 |
| 89 | Ga0466727_234960 | 3300042655 | Bacteria | 2355 |
| 90 | Ga0466712_034745 | 3300042614 | Bacteria | 2740 |
| 91 | Ga0466715_087247 | 3300042616 | Bacteria | 3997 |
| 92 | Ga0466718_134488 | 3300042617 | Bacteria | 1922 |
| 93 | Ga0466723_206366 | 3300042618 | Bacteria | 13029 |
| 94 | Ga0466726_072196 | 3300042619 | Bacteria | 5741 |
| 95 | Ga0466706_021009 | 3300042599 | Bacteria | 55440 |
| 96 | Ga0466706_059794 | 3300042599 | Bacteria | 8358 |
| 97 | Ga0466719_080445 | 3300042606 | Unclassified | 1640 |
| 98 | Ga0466719_108955 | 3300042606 | Bacteria | 41298 |
| 99 | Ga0466720_219584 | 3300042607 | Bacteria | 92443 |
| 100 | 2227655179 | 2225789004 | Bacteria | 10661 |
| 101 | Ga0072941_1000182 | 3300005201 | Bacteria | 10449 |
| 102 | Ga0072941_1046320 | 3300005201 | Unclassified | 5780 |
| 103 | Ga0123353_10431967 | 3300010167 | Bacteria | 1947 |
| 104 | Ga0466691_099073 | 3300042593 | Bacteria | 13237 |
| 105 | Ga0466705_127181 | 3300042612 | Bacteria | 6231 |
| 106 | Ga0466705_185690 | 3300042612 | Bacteria | 5411 |
| 107 | Ga0466731_242612 | 3300042622 | Bacteria | 24338 |
| 108 | Ga0466735_065085 | 3300042624 | Bacteria | 1370 |
| 109 | Ga0466703_173156 | 3300042636 | Bacteria | 10084 |
| 110 | Ga0466709_380004 | 3300042648 | Bacteria | 16590 |
| 111 | Ga0466708_033574 | 3300042652 | Bacteria | 2278 |
| 112 | Ga0466708_266879 | 3300042652 | Bacteria | 7667 |
| 113 | Ga0466727_142210 | 3300042655 | Bacteria | 6840 |
| 114 | Ga0466727_182362 | 3300042655 | Bacteria | 1460 |
| 115 | Ga0466727_250305 | 3300042655 | Bacteria | 1493 |
| 116 | Ga0466712_073680 | 3300042614 | Bacteria | 30571 |
| 117 | Ga0466711_504241 | 3300042615 | Bacteria | 4899 |
| 118 | Ga0466715_193860 | 3300042616 | Bacteria | 24563 |
| 119 | Ga0466715_276084 | 3300042616 | Bacteria | 23018 |
| 120 | Ga0466715_353188 | 3300042616 | Bacteria | 4197 |
| 121 | Ga0466715_646645 | 3300042616 | Bacteria | 16949 |
| 122 | Ga0466723_053622 | 3300042618 | Bacteria | 2705 |
| 123 | Ga0466723_258614 | 3300042618 | Bacteria | 13677 |
| 124 | Ga0466726_016359 | 3300042619 | Bacteria | 3204 |
| 125 | Ga0466726_382028 | 3300042619 | Bacteria | 14308 |
| 126 | Ga0466706_071799 | 3300042599 | Unclassified | 11019 |
| 127 | Ga0466713_032120 | 3300042602 | Bacteria | 34196 |
| 128 | Ga0466719_113197 | 3300042606 | Bacteria | 36499 |
| 129 | Ga0466720_094321 | 3300042607 | Bacteria | 9173 |
| 130 | Ga0466721_399557 | 3300042608 | Bacteria | 2796 |
| 131 | Ga0466722_220364 | 3300042609 | Bacteria | 5529 |
| 132 | AustNasuHG_c1004294 | 3300000089 | Bacteria | 5112 |
| 133 | JGI24695J34938_10009848 | 3300002450 | Bacteria | 5283 |
| 134 | Ga0123355_10084380 | 3300009826 | Bacteria | 5058 |
| 135 | Ga0123356_10049089 | 3300010049 | Archaea | 3929 |
| 136 | Ga0466733_127870 | 3300042659 | Bacteria | 6543 |
| 137 | Ga0466692_156417 | 3300042591 | Bacteria | 7156 |
| 138 | Ga0466691_126924 | 3300042593 | Bacteria | 2289 |
| 139 | Ga0466696_007604 | 3300042596 | Bacteria | 11512 |
| 140 | Ga0466696_082242 | 3300042596 | Bacteria | 11475 |
| 141 | Ga0466735_028898 | 3300042624 | Bacteria | 2226 |
| 142 | Ga0466735_158878 | 3300042624 | Bacteria | 2603 |
| 143 | Ga0466703_053693 | 3300042636 | Bacteria | 3483 |
| 144 | Ga0466703_094897 | 3300042636 | Bacteria | 6589 |
| 145 | Ga0466709_234621 | 3300042648 | Bacteria | 8009 |
| 146 | Ga0466708_198043 | 3300042652 | Bacteria | 8639 |
| 147 | Ga0466705_443950 | 3300042612 | Bacteria | 2538 |
| 148 | Ga0466711_259612 | 3300042615 | Bacteria | 3572 |
| 149 | Ga0466718_011564 | 3300042617 | Bacteria | 11165 |
| 150 | Ga0466723_024680 | 3300042618 | Bacteria | 2428 |
| 151 | Ga0466728_067730 | 3300042620 | Bacteria | 16000 |
| 152 | Ga0466706_070749 | 3300042599 | Bacteria | 1804 |
| 153 | Ga0466706_145182 | 3300042599 | Bacteria | 2225 |
| 154 | Ga0466706_196411 | 3300042599 | Bacteria | 7615 |
| 155 | Ga0466706_243046 | 3300042599 | Bacteria | 13633 |
| 156 | Ga0466713_048446 | 3300042602 | Bacteria | 1410 |
| 157 | Ga0466713_074058 | 3300042602 | Unclassified | 6114 |
| 158 | Ga0068305_10009364 | 3300005083 | Unclassified | 49869 |
| 159 | Ga0072941_1006658 | 3300005201 | Unclassified | 9217 |
| 160 | Ga0123355_10000286 | 3300009826 | Bacteria | 64768 |
| 161 | Ga0456237_0002816 | 3300041968 | Bacteria | 2817 |
| 162 | Ga0466692_011167 | 3300042591 | Bacteria | 1903 |
| 163 | Ga0466692_169934 | 3300042591 | Bacteria | 1451 |
| 164 | Ga0466696_079606 | 3300042596 | Bacteria | 4223 |
| 165 | Ga0466699_028711 | 3300042597 | Bacteria | 25309 |
| 166 | Ga0466705_253903 | 3300042612 | Bacteria | 6112 |
| 167 | Ga0466705_254782 | 3300042612 | Bacteria | 2497 |
| 168 | Ga0466705_366553 | 3300042612 | Bacteria | 7041 |
| 169 | Ga0466735_036821 | 3300042624 | Bacteria | 8210 |
| 170 | Ga0466703_006181 | 3300042636 | Bacteria | 4621 |
| 171 | Ga0466703_064376 | 3300042636 | Bacteria | 15867 |
| 172 | Ga0466703_299484 | 3300042636 | Bacteria | 7221 |
| 173 | Ga0466704_180574 | 3300042643 | Bacteria | 4329 |
| 174 | Ga0466704_348763 | 3300042643 | Bacteria | 10761 |
| 175 | Ga0466709_021827 | 3300042648 | Bacteria | 5259 |
| 176 | Ga0466709_053576 | 3300042648 | Bacteria | 26276 |
| 177 | Ga0466705_455838 | 3300042612 | Bacteria | 3223 |
| 178 | Ga0466711_067345 | 3300042615 | Bacteria | 8927 |
| 179 | Ga0466711_343105 | 3300042615 | Bacteria | 3622 |
| 180 | Ga0466718_057926 | 3300042617 | Bacteria | 7543 |
| 181 | Ga0466718_131150 | 3300042617 | Bacteria | 3317 |
| 182 | Ga0466718_143965 | 3300042617 | Bacteria | 1311 |
| 183 | Ga0466726_005056 | 3300042619 | Bacteria | 1516 |
| 184 | Ga0466726_112833 | 3300042619 | Bacteria | 1567 |
| 185 | Ga0466726_179747 | 3300042619 | Bacteria | 1558 |
| 186 | Ga0466728_267541 | 3300042620 | Bacteria | 4079 |
| 187 | Ga0466706_168527 | 3300042599 | Bacteria | 4805 |
| 188 | Ga0466716_067476 | 3300042605 | Bacteria | 9068 |
| 189 | Ga0466716_075377 | 3300042605 | Bacteria | 10766 |
| 190 | Ga0466722_006287 | 3300042609 | Bacteria | 4538 |
| 191 | Ga0466722_049258 | 3300042609 | Bacteria | 20749 |
| 192 | Ga0466722_077688 | 3300042609 | Bacteria | 4771 |
| 193 | Ga0466722_138242 | 3300042609 | Bacteria | 2401 |
| 194 | Ga0466698_341408 | 3300042610 | Bacteria | 1859 |
| 195 | JGI24698J34947_10003886 | 3300002449 | Bacteria | 8127 |
| 196 | JGI24698J34947_10011768 | 3300002449 | Bacteria | 4803 |
| 197 | Ga0123357_10007562 | 3300009784 | Bacteria | 13444 |
| 198 | Ga0466733_096187 | 3300042659 | Bacteria | 5088 |
| 199 | Ga0466692_019094 | 3300042591 | Bacteria | 6260 |
| 200 | Ga0466691_086423 | 3300042593 | Bacteria | 57002 |
| 201 | Ga0466691_107802 | 3300042593 | Bacteria | 4095 |
| 202 | Ga0466694_001376 | 3300042594 | Bacteria | 4747 |
| 203 | Ga0466699_232483 | 3300042597 | Bacteria | 2817 |
| 204 | Ga0466703_084579 | 3300042636 | Bacteria | 11762 |
| 205 | Ga0466703_151321 | 3300042636 | Bacteria | 26945 |
| 206 | Ga0466703_165810 | 3300042636 | Bacteria | 5915 |
| 207 | Ga0466704_197602 | 3300042643 | Bacteria | 3661 |
| 208 | Ga0466709_215284 | 3300042648 | Bacteria | 28810 |
| 209 | Ga0466708_199325 | 3300042652 | Bacteria | 14346 |
| 210 | Ga0466727_165651 | 3300042655 | Bacteria | 21316 |
| 211 | Ga0466712_117871 | 3300042614 | Bacteria | 33194 |
| 212 | Ga0466712_182634 | 3300042614 | Bacteria | 4022 |
| 213 | Ga0466715_107354 | 3300042616 | Bacteria | 21218 |
| 214 | Ga0466728_078215 | 3300042620 | Bacteria | 4596 |
| 215 | Ga0466728_128101 | 3300042620 | Bacteria | 11984 |
| 216 | Ga0466706_003247 | 3300042599 | Bacteria | 3679 |
| 217 | Ga0466706_098209 | 3300042599 | Bacteria | 3769 |
| 218 | Ga0466716_247787 | 3300042605 | Bacteria | 10104 |
| 219 | Ga0466719_213840 | 3300042606 | Bacteria | 5204 |
| 220 | Ga0466719_310336 | 3300042606 | Bacteria | 4278 |
| 221 | Ga0466721_012392 | 3300042608 | Bacteria | 117035 |
| 222 | Ga0466722_033589 | 3300042609 | Bacteria | 3547 |
| 223 | Ga0466722_079374 | 3300042609 | Bacteria | 11583 |
| 224 | Ga0068305_10071619 | 3300005083 | Bacteria | 1651 |
| 225 | Ga0072941_1008697 | 3300005201 | Bacteria | 9655 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.