Protein Family IF00252
Metagenome
Isolate
189
Members
43
Samples
172
Scaffolds
111.09
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0040820|IMNBL1DRAFT_00408203
- Length
- 130 aa
- Sequence
- MEYSQYAFATGPGLEGVGMSFGKMNTFIEILTTQPTKDGEGFVNTGDMIITKIKAYKEDRHGNERWANRAAFSTATALFRFRKQPSLEITTSLYIACGEARYRILSVEDVKGRGMYVEVLTEKLEGTVR*
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.8%
Kalotermitidae
14.3%
Unclassified
11.9%
Termopsidae
7.1%
Rhinotermitidae
4.8%
Passalidae
4.8%
Hodotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 3 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 21 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 22 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_127221 | 3300042611 | Bacteria | 1767 |
| 2 | Ga0466696_205809 | 3300042596 | Unclassified | 1468 |
| 3 | Ga0466706_049546 | 3300042599 | Bacteria | 1242 |
| 4 | Ga0466706_132067 | 3300042599 | Bacteria | 1665 |
| 5 | Ga0466706_215278 | 3300042599 | Bacteria | 1499 |
| 6 | Ga0466706_227979 | 3300042599 | Bacteria | 2191 |
| 7 | Ga0466706_263177 | 3300042599 | Bacteria | 27532 |
| 8 | Ga0466714_048794 | 3300042603 | Bacteria | 1859 |
| 9 | Ga0466717_118511 | 3300042604 | Bacteria | 1288 |
| 10 | Ga0466722_009822 | 3300042609 | Bacteria | 2321 |
| 11 | Ga0123356_10000288 | 3300010049 | Bacteria | 57856 |
| 12 | Ga0123356_10198861 | 3300010049 | Bacteria | 2042 |
| 13 | Ga0123356_10835587 | 3300010049 | Unclassified | 1092 |
| 14 | Ga0123356_11251162 | 3300010049 | Bacteria | 907 |
| 15 | Ga0123353_10027551 | 3300010167 | Bacteria | 8711 |
| 16 | Ga0123353_10120701 | 3300010167 | Bacteria | 4215 |
| 17 | Ga0123353_10261494 | 3300010167 | Bacteria | 2672 |
| 18 | Ga0123353_10366508 | 3300010167 | Bacteria | 2162 |
| 19 | Ga0123353_10762834 | 3300010167 | Bacteria | 1344 |
| 20 | 2227514922 | 2225789004 | Bacteria | 3470 |
| 21 | IMNBL1DRAFT_c0040820 | 3300000062 | Bacteria | 1565 |
| 22 | JGI24696J40584_12818440 | 3300002834 | Bacteria | 903 |
| 23 | Ga0466710_285294 | 3300042613 | Bacteria | 1006 |
| 24 | Ga0415639_129118 | 3300038395 | Bacteria | 1638 |
| 25 | Ga0466734_147629 | 3300042623 | Bacteria | 1035 |
| 26 | Ga0466734_147648 | 3300042623 | Bacteria | 2008 |
| 27 | Ga0466703_017925 | 3300042636 | Bacteria | 18677 |
| 28 | Ga0466703_036427 | 3300042636 | Bacteria | 2749 |
| 29 | Ga0466706_000685 | 3300042599 | Bacteria | 5911 |
| 30 | Ga0466706_082412 | 3300042599 | Bacteria | 3044 |
| 31 | Ga0466706_100706 | 3300042599 | Bacteria | 4323 |
| 32 | Ga0466706_247194 | 3300042599 | Bacteria | 16056 |
| 33 | Ga0466706_261675 | 3300042599 | Bacteria | 2744 |
| 34 | Ga0466707_332832 | 3300042601 | Bacteria | 1775 |
| 35 | Ga0466722_243271 | 3300042609 | Bacteria | 1438 |
| 36 | Ga0123355_10594616 | 3300009826 | Bacteria | 1316 |
| 37 | Ga0123356_10382454 | 3300010049 | Bacteria | 1540 |
| 38 | Ga0123353_10336522 | 3300010167 | Bacteria | 2282 |
| 39 | Ga0123353_10357976 | 3300010167 | Bacteria | 2195 |
| 40 | Ga0123354_10012826 | 3300010882 | Bacteria | 12983 |
| 41 | JGI24702J35022_10035844 | 3300002462 | Bacteria | 2652 |
| 42 | Ga0072941_1177372 | 3300005201 | Bacteria | 12260 |
| 43 | Ga0466733_169308 | 3300042659 | Bacteria | 10774 |
| 44 | Ga0466692_017433 | 3300042591 | Bacteria | 1721 |
| 45 | Ga0466734_091034 | 3300042623 | Bacteria | 1930 |
| 46 | Ga0466735_216101 | 3300042624 | Bacteria | 1695 |
| 47 | Ga0466702_385707 | 3300042635 | Bacteria | 1118 |
| 48 | Ga0466725_159986 | 3300042654 | Bacteria | 1254 |
| 49 | Ga0466706_015702 | 3300042599 | Bacteria | 5330 |
| 50 | Ga0466706_161194 | 3300042599 | Unclassified | 1075 |
| 51 | Ga0466706_164160 | 3300042599 | Bacteria | 1508 |
| 52 | Ga0466706_185875 | 3300042599 | Bacteria | 2838 |
| 53 | Ga0466706_195413 | 3300042599 | Bacteria | 2335 |
| 54 | Ga0466706_206020 | 3300042599 | Bacteria | 1615 |
| 55 | Ga0466706_258401 | 3300042599 | Unclassified | 1706 |
| 56 | Ga0466700_339053 | 3300042600 | Bacteria | 2184 |
| 57 | Ga0466714_007563 | 3300042603 | Bacteria | 3505 |
| 58 | Ga0466716_279446 | 3300042605 | Bacteria | 5037 |
| 59 | Ga0466716_328004 | 3300042605 | Bacteria | 4734 |
| 60 | Ga0466721_063681 | 3300042608 | Unclassified | 1138 |
| 61 | Ga0123357_10661178 | 3300009784 | Bacteria | 768 |
| 62 | Ga0123356_11184316 | 3300010049 | Bacteria | 931 |
| 63 | Ga0123353_10114388 | 3300010167 | Bacteria | 4344 |
| 64 | Ga0123353_10127436 | 3300010167 | Bacteria | 4089 |
| 65 | Ga0123353_10283398 | 3300010167 | Bacteria | 2543 |
| 66 | Ga0123353_10675590 | 3300010167 | Bacteria | 1456 |
| 67 | Ga0123353_11530846 | 3300010167 | Bacteria | 847 |
| 68 | Ga0123353_12591017 | 3300010167 | Bacteria | 600 |
| 69 | JGI24703J35330_11407981 | 3300002501 | Bacteria | 970 |
| 70 | JGI24696J40584_12375532 | 3300002834 | Bacteria | 545 |
| 71 | JGI24696J40584_12853236 | 3300002834 | Bacteria | 988 |
| 72 | Ga0466710_068521 | 3300042613 | Bacteria | 1399 |
| 73 | Ga0466711_261513 | 3300042615 | Bacteria | 44460 |
| 74 | Ga0466726_471284 | 3300042619 | Bacteria | 1919 |
| 75 | Ga0466703_304473 | 3300042636 | Bacteria | 1211 |
| 76 | Ga0466725_312995 | 3300042654 | Bacteria | 1931 |
| 77 | Ga0466706_041996 | 3300042599 | Bacteria | 6704 |
| 78 | Ga0466706_184232 | 3300042599 | Bacteria | 2690 |
| 79 | Ga0466706_190848 | 3300042599 | Bacteria | 5518 |
| 80 | Ga0466706_207816 | 3300042599 | Bacteria | 4784 |
| 81 | Ga0466706_245083 | 3300042599 | Bacteria | 21573 |
| 82 | Ga0466714_018603 | 3300042603 | Bacteria | 1319 |
| 83 | Ga0466716_423176 | 3300042605 | Bacteria | 6676 |
| 84 | Ga0466719_563431 | 3300042606 | Bacteria | 8145 |
| 85 | Ga0466722_125249 | 3300042609 | Bacteria | 1071 |
| 86 | Ga0123356_10705742 | 3300010049 | Unclassified | 1178 |
| 87 | Ga0123356_10788648 | 3300010049 | Bacteria | 1121 |
| 88 | Ga0123356_11314574 | 3300010049 | Bacteria | 886 |
| 89 | Ga0123356_12042509 | 3300010049 | Bacteria | 715 |
| 90 | Ga0123356_12642612 | 3300010049 | Bacteria | 629 |
| 91 | Ga0123353_11128349 | 3300010167 | Bacteria | 1037 |
| 92 | Ga0123353_11218809 | 3300010167 | Bacteria | 985 |
| 93 | Ga0123353_11994881 | 3300010167 | Bacteria | 711 |
| 94 | Ga0123353_13009647 | 3300010167 | Bacteria | 546 |
| 95 | 2227543983 | 2225789004 | Bacteria | 597 |
| 96 | IMNBL1DRAFT_c0033134 | 3300000062 | Bacteria | 1853 |
| 97 | JGI24702J35022_10166958 | 3300002462 | Bacteria | 1243 |
| 98 | Ga0466718_134995 | 3300042617 | Bacteria | 1771 |
| 99 | Ga0415639_123596 | 3300038395 | Bacteria | 2094 |
| 100 | Ga0466731_045725 | 3300042622 | Bacteria | 2030 |
| 101 | Ga0466731_055664 | 3300042622 | Bacteria | 1342 |
| 102 | Ga0466734_028901 | 3300042623 | Archaea | 1045 |
| 103 | Ga0466727_237457 | 3300042655 | Bacteria | 1380 |
| 104 | Ga0466706_034680 | 3300042599 | Bacteria | 3540 |
| 105 | Ga0466706_047291 | 3300042599 | Bacteria | 2677 |
| 106 | Ga0466706_070812 | 3300042599 | Bacteria | 1860 |
| 107 | Ga0466706_127820 | 3300042599 | Bacteria | 1287 |
| 108 | Ga0466706_166491 | 3300042599 | Bacteria | 4219 |
| 109 | Ga0466706_192203 | 3300042599 | Bacteria | 1058 |
| 110 | Ga0466707_113591 | 3300042601 | Bacteria | 1561 |
| 111 | Ga0466707_120499 | 3300042601 | Bacteria | 1033 |
| 112 | Ga0466717_305038 | 3300042604 | Bacteria | 1707 |
| 113 | Ga0123355_10971851 | 3300009826 | Bacteria | 907 |
| 114 | Ga0123356_10220304 | 3300010049 | Bacteria | 1953 |
| 115 | Ga0123356_10442476 | 3300010049 | Bacteria | 1446 |
| 116 | Ga0123353_10030511 | 3300010167 | Bacteria | 8332 |
| 117 | Ga0123353_13061475 | 3300010167 | Bacteria | 540 |
| 118 | Ga0466715_426077 | 3300042616 | Bacteria | 1496 |
| 119 | Ga0466726_229179 | 3300042619 | Bacteria | 1141 |
| 120 | Ga0415639_101313 | 3300038395 | Bacteria | 2515 |
| 121 | Ga0466692_083623 | 3300042591 | Bacteria | 3392 |
| 122 | Ga0466706_025574 | 3300042599 | Bacteria | 3708 |
| 123 | Ga0466706_136071 | 3300042599 | Bacteria | 3171 |
| 124 | Ga0466706_197078 | 3300042599 | Bacteria | 1111 |
| 125 | Ga0466706_219803 | 3300042599 | Bacteria | 1236 |
| 126 | Ga0466706_220490 | 3300042599 | Bacteria | 222739 |
| 127 | Ga0466713_079928 | 3300042602 | Bacteria | 1560 |
| 128 | Ga0466714_119335 | 3300042603 | Bacteria | 18167 |
| 129 | Ga0466722_184929 | 3300042609 | Bacteria | 1545 |
| 130 | Ga0466698_478235 | 3300042610 | Bacteria | 1109 |
| 131 | Ga0123357_10156996 | 3300009784 | Bacteria | 2740 |
| 132 | Ga0123355_10000511 | 3300009826 | Bacteria | 51686 |
| 133 | Ga0123355_10012767 | 3300009826 | Bacteria | 13028 |
| 134 | JGI24702J35022_10036335 | 3300002462 | Bacteria | 2633 |
| 135 | JGI24702J35022_10250092 | 3300002462 | Bacteria | 1031 |
| 136 | Ga0466718_134588 | 3300042617 | Bacteria | 1641 |
| 137 | Ga0466731_155398 | 3300042622 | Bacteria | 1594 |
| 138 | Ga0466727_230723 | 3300042655 | Bacteria | 2030 |
| 139 | Ga0466727_255976 | 3300042655 | Bacteria | 11598 |
| 140 | Ga0466706_056467 | 3300042599 | Bacteria | 1287 |
| 141 | Ga0466706_199439 | 3300042599 | Bacteria | 2193 |
| 142 | Ga0466706_223509 | 3300042599 | Unclassified | 1061 |
| 143 | Ga0466706_228630 | 3300042599 | Bacteria | 2385 |
| 144 | Ga0466706_247379 | 3300042599 | Bacteria | 12779 |
| 145 | Ga0466700_454074 | 3300042600 | Bacteria | 1265 |
| 146 | Ga0466707_270662 | 3300042601 | Bacteria | 2224 |
| 147 | Ga0466716_120808 | 3300042605 | Bacteria | 1726 |
| 148 | Ga0466722_154774 | 3300042609 | Bacteria | 3215 |
| 149 | Ga0466722_258884 | 3300042609 | Bacteria | 3833 |
| 150 | Ga0123357_10750559 | 3300009784 | Bacteria | 679 |
| 151 | Ga0123356_10694419 | 3300010049 | Bacteria | 1186 |
| 152 | Ga0123356_10744515 | 3300010049 | Bacteria | 1150 |
| 153 | Ga0123356_11163023 | 3300010049 | Unclassified | 938 |
| 154 | Ga0123356_12176502 | 3300010049 | Bacteria | 693 |
| 155 | Ga0123353_11498081 | 3300010167 | Bacteria | 859 |
| 156 | JGI24702J35022_10027564 | 3300002462 | Bacteria | 3056 |
| 157 | Ga0466718_151172 | 3300042617 | Bacteria | 2824 |
| 158 | Ga0466695_111268 | 3300042595 | Bacteria | 1338 |
| 159 | Ga0466703_198457 | 3300042636 | Bacteria | 5934 |
| 160 | Ga0466706_010727 | 3300042599 | Bacteria | 3505 |
| 161 | Ga0466706_045766 | 3300042599 | Bacteria | 13628 |
| 162 | Ga0466706_090213 | 3300042599 | Bacteria | 3028 |
| 163 | Ga0466706_208761 | 3300042599 | Bacteria | 1545 |
| 164 | Ga0466706_267492 | 3300042599 | Bacteria | 2877 |
| 165 | Ga0466707_356019 | 3300042601 | Bacteria | 1695 |
| 166 | Ga0123355_11558503 | 3300009826 | Unclassified | 640 |
| 167 | Ga0123356_10423926 | 3300010049 | Bacteria | 1473 |
| 168 | Ga0123353_10567662 | 3300010167 | Bacteria | 1632 |
| 169 | Ga0123353_10985462 | 3300010167 | Unclassified | 1135 |
| 170 | JGI24702J35022_10011025 | 3300002462 | Bacteria | 5038 |
| 171 | JGI24702J35022_10056144 | 3300002462 | Bacteria | 2101 |
| 172 | JGI24696J40584_12958977 | 3300002834 | Bacteria | 4597 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05521 | Phage_H_T_join | Phage head-tail joining protein | 19 | 122 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.