Protein Family IF00240
Metagenome
Isolate
164
Members
66
Samples
148
Scaffolds
314.93
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0007499|IMNBL1DRAFT_00074993
- Length
- 318 aa
- Sequence
- MNVMTKIAKKLTDLIGNTPLLELVTFGQYHSLSARLIGKLEYFNPAGSVKDRVALAMIEDAESKGILKSGSVIIEPTSGNTGVGLAFVSVVKGYRIILTMPETMSIERRNLLKAFGAEVVLTNGADGMKGAIAKAENLHNEIPNSVILQQFENPANPAIHSKTAEEIWKDTNQHVDIFVAGVGTGGTISGVGKRLKELNPKVQIVAVEPADSPVLSGGIQGAHKIQGIGAGFVPKIFDSSVVDTIITVSNDEAIRTSRELTKTEGLLIGISSGAATYAAVNLAKLSENRDKNIVVMLPDTGERYLSTVLYSFDEYPL*
Sample Types
Isolate
9.8%
Metagenome
90.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
20.6%
Kalotermitidae
20.6%
Blattidae
6.3%
Termopsidae
4.8%
Rhinotermitidae
3.2%
Drosophilidae
3.2%
Passalidae
3.2%
Apidae
1.6%
Hodotermitidae
1.6%
Armadillidiidae
1.6%
Taxonomy
Archaea
1
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 4 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 23 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 31 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 43 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 44 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 45 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 46 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 47 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 59 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 62 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0104040_1001439 | 3300007149 | Bacteria | 2178 |
| 2 | Ga0123357_10112556 | 3300009784 | Bacteria | 3463 |
| 3 | Ga0123355_10002122 | 3300009826 | Bacteria | 27995 |
| 4 | Ga0466706_046183 | 3300042599 | Bacteria | 4319 |
| 5 | Ga0466707_013194 | 3300042601 | Bacteria | 2547 |
| 6 | Ga0466714_075627 | 3300042603 | Bacteria | 1482 |
| 7 | Ga0466722_137996 | 3300042609 | Bacteria | 3002 |
| 8 | Ga0466711_036443 | 3300042615 | Unclassified | 3226 |
| 9 | Ga0466715_542902 | 3300042616 | Bacteria | 6030 |
| 10 | Ga0466723_042738 | 3300042618 | Bacteria | 46355 |
| 11 | Ga0466705_149433 | 3300042612 | Bacteria | 10726 |
| 12 | Ga0466696_235308 | 3300042596 | Bacteria | 27401 |
| 13 | Ga0466733_151008 | 3300042659 | Bacteria | 3881 |
| 14 | Ga0072941_1326357 | 3300005201 | Bacteria | 1663 |
| 15 | Ga0123353_10759176 | 3300010167 | Bacteria | 1348 |
| 16 | Ga0123354_10140035 | 3300010882 | Bacteria | 2999 |
| 17 | Ga0466706_065550 | 3300042599 | Bacteria | 22203 |
| 18 | Ga0466706_288768 | 3300042599 | Bacteria | 1833 |
| 19 | Ga0466700_047234 | 3300042600 | Bacteria | 31011 |
| 20 | Ga0466713_053726 | 3300042602 | Bacteria | 131027 |
| 21 | Ga0466713_109457 | 3300042602 | Bacteria | 80949 |
| 22 | Ga0466711_441474 | 3300042615 | Bacteria | 2378 |
| 23 | Ga0466726_081656 | 3300042619 | Bacteria | 25380 |
| 24 | Ga0466703_270825 | 3300042636 | Bacteria | 10380 |
| 25 | Ga0466725_350213 | 3300042654 | Bacteria | 33385 |
| 26 | Ga0264413_101286 | 3300024493 | Bacteria | 17003 |
| 27 | Ga0466690_003105 | 3300042590 | Bacteria | 52820 |
| 28 | JGI24699J35502_11133749 | 3300002509 | Bacteria | 14709 |
| 29 | Ga0123357_10001408 | 3300009784 | Bacteria | 25449 |
| 30 | Ga0466706_013618 | 3300042599 | Bacteria | 9134 |
| 31 | Ga0466706_042492 | 3300042599 | Bacteria | 22506 |
| 32 | Ga0466706_182722 | 3300042599 | Bacteria | 29146 |
| 33 | Ga0466706_212852 | 3300042599 | Bacteria | 14828 |
| 34 | Ga0466713_039218 | 3300042602 | Bacteria | 14247 |
| 35 | Ga0466714_097870 | 3300042603 | Bacteria | 6473 |
| 36 | Ga0466714_151135 | 3300042603 | Bacteria | 2581 |
| 37 | Ga0466711_042164 | 3300042615 | Bacteria | 7771 |
| 38 | Ga0466711_061554 | 3300042615 | Bacteria | 22853 |
| 39 | Ga0466715_073321 | 3300042616 | Bacteria | 18269 |
| 40 | Ga0466715_081089 | 3300042616 | Bacteria | 5896 |
| 41 | Ga0466704_067267 | 3300042643 | Bacteria | 9780 |
| 42 | Ga0466691_096683 | 3300042593 | Bacteria | 10540 |
| 43 | Ga0466696_002390 | 3300042596 | Bacteria | 8040 |
| 44 | Ga0466733_088268 | 3300042659 | Unclassified | 4702 |
| 45 | 2227524645 | 2225789004 | Bacteria | 3271 |
| 46 | IMNBL1DRAFT_c0007499 | 3300000062 | Bacteria | 5727 |
| 47 | JGI24699J35502_11134210 | 3300002509 | Bacteria | 59774 |
| 48 | JGI24696J40584_12950721 | 3300002834 | Bacteria | 2175 |
| 49 | Ga0072941_1211758 | 3300005201 | Bacteria | 2360 |
| 50 | Ga0123357_10007413 | 3300009784 | Bacteria | 13554 |
| 51 | Ga0123357_10411319 | 3300009784 | Bacteria | 1219 |
| 52 | Ga0123355_10002398 | 3300009826 | Bacteria | 26488 |
| 53 | Ga0123353_10266538 | 3300010167 | Bacteria | 2642 |
| 54 | Ga0466706_028678 | 3300042599 | Bacteria | 3059 |
| 55 | Ga0466706_028721 | 3300042599 | Bacteria | 5568 |
| 56 | Ga0466706_121013 | 3300042599 | Bacteria | 9780 |
| 57 | Ga0466707_272109 | 3300042601 | Bacteria | 19065 |
| 58 | Ga0466719_327872 | 3300042606 | Bacteria | 1449 |
| 59 | Ga0466698_293476 | 3300042610 | Bacteria | 1136 |
| 60 | Ga0466711_226717 | 3300042615 | Bacteria | 7046 |
| 61 | Ga0466711_484067 | 3300042615 | Bacteria | 2475 |
| 62 | Ga0466726_390789 | 3300042619 | Bacteria | 4683 |
| 63 | Ga0466705_255953 | 3300042612 | Unclassified | 1412 |
| 64 | Ga0466702_012993 | 3300042635 | Bacteria | 1889 |
| 65 | Ga0466704_149449 | 3300042643 | Bacteria | 9859 |
| 66 | Ga0466727_114271 | 3300042655 | Bacteria | 3570 |
| 67 | Ga0466690_165110 | 3300042590 | Bacteria | 20376 |
| 68 | Ga0466696_160910 | 3300042596 | Bacteria | 12370 |
| 69 | Ga0466733_129055 | 3300042659 | Bacteria | 17401 |
| 70 | JGI24702J35022_10128253 | 3300002462 | Bacteria | 1406 |
| 71 | Ga0123356_10000522 | 3300010049 | Bacteria | 42650 |
| 72 | Ga0123354_10000687 | 3300010882 | Bacteria | 36022 |
| 73 | Ga0123354_10022331 | 3300010882 | Bacteria | 9977 |
| 74 | Ga0466701_069735 | 3300042598 | Bacteria | 6655 |
| 75 | Ga0466706_133469 | 3300042599 | Bacteria | 14669 |
| 76 | Ga0466706_184382 | 3300042599 | Bacteria | 1709 |
| 77 | Ga0466714_064217 | 3300042603 | Bacteria | 3177 |
| 78 | Ga0466711_224338 | 3300042615 | Bacteria | 13307 |
| 79 | Ga0466705_145863 | 3300042612 | Bacteria | 10136 |
| 80 | Ga0466703_195295 | 3300042636 | Bacteria | 15480 |
| 81 | Ga0466704_279867 | 3300042643 | Bacteria | 7231 |
| 82 | Ga0466708_299612 | 3300042652 | Bacteria | 12375 |
| 83 | Ga0466725_168201 | 3300042654 | Bacteria | 25218 |
| 84 | Ga0160456_106049 | 3300012820 | Bacteria | 1430 |
| 85 | Ga0160452_100084 | 3300012834 | Bacteria | 123536 |
| 86 | Ga0466690_303437 | 3300042590 | Bacteria | 1675 |
| 87 | Ga0466692_067935 | 3300042591 | Bacteria | 92005 |
| 88 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 89 | Ga0466699_385250 | 3300042597 | Bacteria | 1535 |
| 90 | Ga0466732_421119 | 3300042656 | Bacteria | 54820 |
| 91 | JGI24695J34938_10033345 | 3300002450 | Bacteria | 2369 |
| 92 | Ga0104042_1000609 | 3300007130 | Bacteria | 2256 |
| 93 | Ga0123357_10106248 | 3300009784 | Bacteria | 3599 |
| 94 | Ga0123355_10000592 | 3300009826 | Bacteria | 48877 |
| 95 | Ga0123355_10023936 | 3300009826 | Bacteria | 9808 |
| 96 | Ga0123355_10313804 | 3300009826 | Bacteria | 2121 |
| 97 | Ga0123353_10082090 | 3300010167 | Bacteria | 5184 |
| 98 | Ga0123354_10036143 | 3300010882 | Bacteria | 7705 |
| 99 | Ga0466700_193315 | 3300042600 | Bacteria | 8174 |
| 100 | Ga0466714_061849 | 3300042603 | Bacteria | 4066 |
| 101 | Ga0466714_117493 | 3300042603 | Bacteria | 34193 |
| 102 | Ga0466722_076037 | 3300042609 | Bacteria | 11665 |
| 103 | Ga0466712_090584 | 3300042614 | Bacteria | 1314 |
| 104 | Ga0466726_380659 | 3300042619 | Unclassified | 4383 |
| 105 | Ga0466705_016709 | 3300042612 | Bacteria | 4832 |
| 106 | Ga0466708_287549 | 3300042652 | Bacteria | 5031 |
| 107 | Ga0466657_046695 | 3300042582 | Bacteria | 2625 |
| 108 | Ga0466690_035694 | 3300042590 | Bacteria | 4730 |
| 109 | Ga0466696_018570 | 3300042596 | Unclassified | 3284 |
| 110 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 111 | IMNBL1DRAFT_c0006878 | 3300000062 | Bacteria | 6106 |
| 112 | Ga0123354_10001938 | 3300010882 | Bacteria | 26389 |
| 113 | Ga0466706_002708 | 3300042599 | Bacteria | 9728 |
| 114 | Ga0466707_130829 | 3300042601 | Bacteria | 9553 |
| 115 | Ga0466713_086263 | 3300042602 | Bacteria | 5160 |
| 116 | Ga0466714_158934 | 3300042603 | Bacteria | 2620 |
| 117 | Ga0466712_113475 | 3300042614 | Bacteria | 1067 |
| 118 | Ga0466715_061300 | 3300042616 | Bacteria | 7608 |
| 119 | Ga0466715_118812 | 3300042616 | Bacteria | 9918 |
| 120 | Ga0466723_165155 | 3300042618 | Bacteria | 30063 |
| 121 | Ga0466728_217653 | 3300042620 | Bacteria | 6503 |
| 122 | Ga0466705_028707 | 3300042612 | Bacteria | 6535 |
| 123 | Ga0466730_061420 | 3300042625 | Bacteria | 5181 |
| 124 | Ga0466703_305000 | 3300042636 | Bacteria | 5425 |
| 125 | Ga0466704_285742 | 3300042643 | Bacteria | 10079 |
| 126 | Ga0466709_133488 | 3300042648 | Bacteria | 69029 |
| 127 | Ga0466709_281639 | 3300042648 | Bacteria | 14893 |
| 128 | Ga0466696_060862 | 3300042596 | Bacteria | 9085 |
| 129 | Ga0466733_032546 | 3300042659 | Unclassified | 8070 |
| 130 | JGI24699J35502_11133880 | 3300002509 | Bacteria | 17881 |
| 131 | Ga0123357_10007351 | 3300009784 | Bacteria | 13603 |
| 132 | Ga0123357_10028333 | 3300009784 | Bacteria | 7579 |
| 133 | Ga0123357_10099302 | 3300009784 | Bacteria | 3759 |
| 134 | Ga0123355_10249122 | 3300009826 | Bacteria | 2504 |
| 135 | Ga0123356_10000518 | 3300010049 | Bacteria | 42876 |
| 136 | Ga0123353_10001341 | 3300010167 | Bacteria | 30191 |
| 137 | Ga0466706_093924 | 3300042599 | Bacteria | 57491 |
| 138 | Ga0466706_111719 | 3300042599 | Bacteria | 6663 |
| 139 | Ga0466700_307908 | 3300042600 | Bacteria | 4471 |
| 140 | Ga0466719_033013 | 3300042606 | Bacteria | 9653 |
| 141 | Ga0466715_491855 | 3300042616 | Bacteria | 4906 |
| 142 | Ga0466705_301512 | 3300042612 | Bacteria | 1252 |
| 143 | Ga0466705_310521 | 3300042612 | Bacteria | 78321 |
| 144 | Ga0466735_023041 | 3300042624 | Bacteria | 2207 |
| 145 | Ga0466708_296454 | 3300042652 | Bacteria | 54366 |
| 146 | Ga0466692_146086 | 3300042591 | Bacteria | 2399 |
| 147 | Ga0466696_224181 | 3300042596 | Bacteria | 6173 |
| 148 | Ga0466696_227064 | 3300042596 | Bacteria | 35618 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 12 | 299 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.