Protein Family IF00221
Metagenome
Isolate
267
Members
99
Samples
226
Scaffolds
273.96
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0002999|IMNBL1DRAFT_00029995
- Length
- 310 aa
- Sequence
- MKNLLLRALTGTVYVALVTASILIKSSFFLVLFGLLMILSLYEFYGLIGASKKASVNPFFNSLAGILLFFPTYFYMIGAAGAEFFLLYPLYLVAVFVAELYRKKEDPLQNLAYTFLGHIYIALPFTLLNLLAFQADGTGGMQYSPMLVLALFVFIWVNDSGAYLVGVTIGKHRLFERISPKKSWEGFFGGLIFTALSSLVFYHFKPEIPYYHWIGIAVVVVIFGTWGDLVESLMKRALNVKDSGNTLPGHGGFLDRFDSLLLAVYGIVFYVWLFVRXLGFTIKEIFSTHILQKSSQISPSTCFISVLTL*
Sample Types
Isolate
15.4%
Metagenome
84.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.7%
Blattidae
21.6%
Unclassified
14.4%
Kalotermitidae
14.4%
Rhinotermitidae
6.2%
Termopsidae
4.1%
Passalidae
3.1%
Drosophilidae
2.1%
Hydrophilidae
2.1%
Elmidae
1.0%
Culicidae
1.0%
Formicidae
1.0%
Armadillidiidae
1.0%
Hodotermitidae
1.0%
Apidae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 3 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 4 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 5 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 6 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 9 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 10 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 11 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 19 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 20 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 21 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 25 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 28 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 38 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 39 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 40 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 41 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 42 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 43 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 52 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 53 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 54 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 55 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 58 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 59 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 60 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 66 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 67 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 68 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 76 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 77 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 78 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 79 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 80 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 81 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 82 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 83 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 84 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 85 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 86 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 87 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 88 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 89 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 90 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 91 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 92 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 93 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 94 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 95 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 96 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 97 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 98 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 99 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10092081 | 3300010167 | Bacteria | 4883 |
| 2 | Ga0123353_10478486 | 3300010167 | Bacteria | 1823 |
| 3 | Ga0123353_10853751 | 3300010167 | Bacteria | 1247 |
| 4 | Ga0466701_097129 | 3300042598 | Bacteria | 12609 |
| 5 | Ga0466713_010854 | 3300042602 | Bacteria | 23476 |
| 6 | Ga0466716_021809 | 3300042605 | Bacteria | 14137 |
| 7 | Ga0466722_021893 | 3300042609 | Bacteria | 7217 |
| 8 | Ga0466722_033716 | 3300042609 | Bacteria | 7442 |
| 9 | Ga0466733_061973 | 3300042659 | Bacteria | 4791 |
| 10 | Ga0466690_009119 | 3300042590 | Bacteria | 57867 |
| 11 | Ga0466692_036798 | 3300042591 | Bacteria | 21349 |
| 12 | 2227216908 | 2225789004 | Bacteria | 7527 |
| 13 | JGI24699J35502_11133898 | 3300002509 | Bacteria | 18539 |
| 14 | Ga0068305_10039880 | 3300005083 | Unclassified | 2289 |
| 15 | Ga0072940_1400920 | 3300005200 | Bacteria | 1018 |
| 16 | Ga0104042_1122159 | 3300007130 | Bacteria | 1612 |
| 17 | Ga0466697_193042 | 3300042611 | Bacteria | 1344 |
| 18 | Ga0466705_304958 | 3300042612 | Bacteria | 2314 |
| 19 | Ga0466735_018490 | 3300042624 | Bacteria | 1218 |
| 20 | Ga0466735_086360 | 3300042624 | Bacteria | 1364 |
| 21 | Ga0466704_058422 | 3300042643 | Bacteria | 11898 |
| 22 | Ga0466708_191459 | 3300042652 | Bacteria | 24833 |
| 23 | Ga0466705_469924 | 3300042612 | Bacteria | 4390 |
| 24 | Ga0466710_330405 | 3300042613 | Bacteria | 15350 |
| 25 | Ga0466728_016383 | 3300042620 | Bacteria | 48703 |
| 26 | Ga0123353_10039498 | 3300010167 | Unclassified | 7430 |
| 27 | Ga0123354_10062023 | 3300010882 | Bacteria | 5510 |
| 28 | Ga0466701_028403 | 3300042598 | Bacteria | 3849 |
| 29 | Ga0466701_046298 | 3300042598 | Unclassified | 6864 |
| 30 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 31 | Ga0466706_191312 | 3300042599 | Bacteria | 38010 |
| 32 | Ga0466706_275151 | 3300042599 | Bacteria | 1791 |
| 33 | Ga0466700_176784 | 3300042600 | Bacteria | 34366 |
| 34 | Ga0466707_017525 | 3300042601 | Bacteria | 3155 |
| 35 | Ga0466707_275002 | 3300042601 | Bacteria | 6933 |
| 36 | Ga0466713_078595 | 3300042602 | Bacteria | 10026 |
| 37 | Ga0466713_102098 | 3300042602 | Bacteria | 100663 |
| 38 | Ga0466714_018529 | 3300042603 | Bacteria | 86040 |
| 39 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 40 | Ga0466719_031867 | 3300042606 | Bacteria | 4893 |
| 41 | Ga0466719_479500 | 3300042606 | Bacteria | 1952 |
| 42 | Ga0466733_003382 | 3300042659 | Bacteria | 6262 |
| 43 | Ga0466692_198960 | 3300042591 | Bacteria | 40644 |
| 44 | 2227557117 | 2225789004 | Bacteria | 2771 |
| 45 | IMNBL1DRAFT_c0002344 | 3300000062 | Bacteria | 13265 |
| 46 | JGI24705J35276_12238575 | 3300002504 | Bacteria | 27186 |
| 47 | Ga0068305_10149870 | 3300005083 | Bacteria | 12355 |
| 48 | Ga0466729_314580 | 3300042621 | Bacteria | 8619 |
| 49 | Ga0466703_242441 | 3300042636 | Bacteria | 6116 |
| 50 | Ga0466704_004777 | 3300042643 | Bacteria | 6364 |
| 51 | Ga0466709_318564 | 3300042648 | Bacteria | 16664 |
| 52 | Ga0466710_031704 | 3300042613 | Bacteria | 2548 |
| 53 | Ga0466715_077348 | 3300042616 | Bacteria | 14977 |
| 54 | Ga0466723_069192 | 3300042618 | Bacteria | 1063 |
| 55 | Ga0466726_129473 | 3300042619 | Bacteria | 22586 |
| 56 | Ga0466728_060083 | 3300042620 | Bacteria | 86084 |
| 57 | Ga0466728_090947 | 3300042620 | Bacteria | 1104 |
| 58 | Ga0466728_255529 | 3300042620 | Bacteria | 3912 |
| 59 | Ga0466706_027212 | 3300042599 | Bacteria | 5642 |
| 60 | Ga0466706_067252 | 3300042599 | Bacteria | 25145 |
| 61 | Ga0466706_171731 | 3300042599 | Bacteria | 1493 |
| 62 | Ga0466707_144472 | 3300042601 | Bacteria | 2787 |
| 63 | Ga0466707_298681 | 3300042601 | Bacteria | 31882 |
| 64 | Ga0466713_108443 | 3300042602 | Bacteria | 74837 |
| 65 | Ga0466714_000739 | 3300042603 | Bacteria | 1675 |
| 66 | Ga0466714_078287 | 3300042603 | Bacteria | 5572 |
| 67 | Ga0466698_186521 | 3300042610 | Bacteria | 3168 |
| 68 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 69 | Ga0160459_108478 | 3300012831 | Bacteria | 1265 |
| 70 | IMNBL1DRAFT_c0002262 | 3300000062 | Bacteria | 13550 |
| 71 | IMNBL1DRAFT_c0009421 | 3300000062 | Bacteria | 4819 |
| 72 | JGI24702J35022_10001791 | 3300002462 | Bacteria | 13247 |
| 73 | JGI24696J40584_12960142 | 3300002834 | Bacteria | 6432 |
| 74 | Ga0068305_10399277 | 3300005083 | Bacteria | 2877 |
| 75 | Ga0466729_280150 | 3300042621 | Bacteria | 10011 |
| 76 | Ga0466703_269236 | 3300042636 | Bacteria | 2360 |
| 77 | Ga0466703_404378 | 3300042636 | Bacteria | 3988 |
| 78 | Ga0466704_138243 | 3300042643 | Bacteria | 15014 |
| 79 | Ga0466704_483944 | 3300042643 | Bacteria | 2658 |
| 80 | Ga0466704_530737 | 3300042643 | Bacteria | 62264 |
| 81 | Ga0466709_089898 | 3300042648 | Bacteria | 6426 |
| 82 | Ga0466708_067774 | 3300042652 | Bacteria | 4325 |
| 83 | Ga0466708_299612 | 3300042652 | Bacteria | 12375 |
| 84 | Ga0466715_099528 | 3300042616 | Bacteria | 23561 |
| 85 | Ga0466715_178918 | 3300042616 | Bacteria | 8231 |
| 86 | Ga0466715_480711 | 3300042616 | Bacteria | 22723 |
| 87 | Ga0466726_075151 | 3300042619 | Bacteria | 2623 |
| 88 | Ga0466729_153704 | 3300042621 | Bacteria | 53339 |
| 89 | Ga0123354_10000021 | 3300010882 | Bacteria | 122100 |
| 90 | Ga0123354_10082613 | 3300010882 | Bacteria | 4527 |
| 91 | Ga0123354_10314607 | 3300010882 | Bacteria | 1456 |
| 92 | Ga0466706_062359 | 3300042599 | Bacteria | 21019 |
| 93 | Ga0466706_156694 | 3300042599 | Bacteria | 5274 |
| 94 | Ga0466706_239192 | 3300042599 | Bacteria | 6245 |
| 95 | Ga0466713_078339 | 3300042602 | Bacteria | 10216 |
| 96 | Ga0466713_126719 | 3300042602 | Bacteria | 8343 |
| 97 | Ga0466714_152612 | 3300042603 | Bacteria | 4729 |
| 98 | Ga0466722_181282 | 3300042609 | Bacteria | 1073 |
| 99 | Ga0466698_457262 | 3300042610 | Bacteria | 2130 |
| 100 | Ga0466733_067642 | 3300042659 | Bacteria | 12444 |
| 101 | Ga0466733_150639 | 3300042659 | Bacteria | 185699 |
| 102 | Ga0466733_183260 | 3300042659 | Bacteria | 1381 |
| 103 | Ga0466657_282634 | 3300042582 | Bacteria | 1972 |
| 104 | Ga0466690_104560 | 3300042590 | Bacteria | 1030 |
| 105 | Ga0466691_027968 | 3300042593 | Bacteria | 11390 |
| 106 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 107 | IMNBL1DRAFT_c0013398 | 3300000062 | Bacteria | 3680 |
| 108 | IMNBL1DRAFT_c0028095 | 3300000062 | Bacteria | 2104 |
| 109 | Ga0068305_10031114 | 3300005083 | Bacteria | 19538 |
| 110 | Ga0123357_10000445 | 3300009784 | Bacteria | 39844 |
| 111 | Ga0466703_168722 | 3300042636 | Bacteria | 14641 |
| 112 | Ga0466708_083679 | 3300042652 | Bacteria | 1262 |
| 113 | Ga0466710_182652 | 3300042613 | Bacteria | 5805 |
| 114 | Ga0466715_124048 | 3300042616 | Bacteria | 12853 |
| 115 | Ga0466715_303208 | 3300042616 | Bacteria | 19718 |
| 116 | Ga0466723_068779 | 3300042618 | Bacteria | 9515 |
| 117 | Ga0123354_10000146 | 3300010882 | Bacteria | 55170 |
| 118 | Ga0123354_10181671 | 3300010882 | Bacteria | 2398 |
| 119 | Ga0123354_10318483 | 3300010882 | Bacteria | 1439 |
| 120 | Ga0466707_301858 | 3300042601 | Bacteria | 9528 |
| 121 | Ga0466713_043591 | 3300042602 | Bacteria | 53812 |
| 122 | Ga0466722_018861 | 3300042609 | Bacteria | 3928 |
| 123 | Ga0466722_062199 | 3300042609 | Bacteria | 1785 |
| 124 | Ga0466698_363877 | 3300042610 | Bacteria | 1316 |
| 125 | Ga0466733_082818 | 3300042659 | Bacteria | 21997 |
| 126 | Ga0466733_202134 | 3300042659 | Bacteria | 48711 |
| 127 | Ga0466690_138490 | 3300042590 | Bacteria | 4145 |
| 128 | Ga0466692_179175 | 3300042591 | Bacteria | 1482 |
| 129 | Ga0466694_108625 | 3300042594 | Bacteria | 1442 |
| 130 | IMNBL1DRAFT_c0009293 | 3300000062 | Unclassified | 4870 |
| 131 | JGI24702J35022_10002181 | 3300002462 | Bacteria | 12051 |
| 132 | Ga0068302_10221444 | 3300005071 | Bacteria | 3541 |
| 133 | Ga0466697_208642 | 3300042611 | Bacteria | 2123 |
| 134 | Ga0466705_075718 | 3300042612 | Bacteria | 10576 |
| 135 | Ga0466735_000859 | 3300042624 | Bacteria | 4441 |
| 136 | Ga0466735_028761 | 3300042624 | Bacteria | 11374 |
| 137 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 138 | Ga0466725_272861 | 3300042654 | Bacteria | 1020 |
| 139 | Ga0466711_144149 | 3300042615 | Bacteria | 5347 |
| 140 | Ga0466711_439848 | 3300042615 | Bacteria | 2683 |
| 141 | Ga0466715_071257 | 3300042616 | Bacteria | 7060 |
| 142 | Ga0466715_227671 | 3300042616 | Bacteria | 15822 |
| 143 | Ga0466715_420729 | 3300042616 | Bacteria | 16300 |
| 144 | Ga0466728_166131 | 3300042620 | Bacteria | 8079 |
| 145 | Ga0466729_026211 | 3300042621 | Bacteria | 11096 |
| 146 | Ga0123355_10001208 | 3300009826 | Bacteria | 35998 |
| 147 | Ga0123356_10335131 | 3300010049 | Bacteria | 1631 |
| 148 | Ga0123353_10550878 | 3300010167 | Bacteria | 1663 |
| 149 | Ga0466701_042077 | 3300042598 | Bacteria | 5278 |
| 150 | Ga0466706_099434 | 3300042599 | Unclassified | 1093 |
| 151 | Ga0466706_247567 | 3300042599 | Bacteria | 5157 |
| 152 | Ga0466707_246922 | 3300042601 | Bacteria | 20410 |
| 153 | Ga0466707_342223 | 3300042601 | Bacteria | 4266 |
| 154 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 155 | Ga0466713_059519 | 3300042602 | Bacteria | 10349 |
| 156 | Ga0466716_509041 | 3300042605 | Bacteria | 1936 |
| 157 | Ga0466719_070040 | 3300042606 | Bacteria | 10447 |
| 158 | Ga0466690_378607 | 3300042590 | Bacteria | 22727 |
| 159 | Ga0466693_321587 | 3300042592 | Bacteria | 1657 |
| 160 | Ga0466696_163902 | 3300042596 | Bacteria | 2896 |
| 161 | Ga0068305_10120334 | 3300005083 | Unclassified | 1409 |
| 162 | Ga0466705_189368 | 3300042612 | Unclassified | 3346 |
| 163 | Ga0466705_296607 | 3300042612 | Bacteria | 14960 |
| 164 | Ga0466703_147745 | 3300042636 | Bacteria | 7749 |
| 165 | Ga0466704_040810 | 3300042643 | Bacteria | 25809 |
| 166 | Ga0466704_200293 | 3300042643 | Bacteria | 11812 |
| 167 | Ga0466704_526148 | 3300042643 | Bacteria | 6073 |
| 168 | Ga0466709_049942 | 3300042648 | Bacteria | 22030 |
| 169 | Ga0466724_17278 | 3300042649 | Bacteria | 1857 |
| 170 | Ga0466708_024796 | 3300042652 | Bacteria | 3900 |
| 171 | Ga0466711_029491 | 3300042615 | Bacteria | 24445 |
| 172 | Ga0466711_259918 | 3300042615 | Bacteria | 3823 |
| 173 | Ga0466715_514362 | 3300042616 | Bacteria | 34842 |
| 174 | Ga0466726_478102 | 3300042619 | Bacteria | 2594 |
| 175 | Ga0123357_10039159 | 3300009784 | Bacteria | 6455 |
| 176 | Ga0123356_10069253 | 3300010049 | Bacteria | 3308 |
| 177 | Ga0466706_003565 | 3300042599 | Bacteria | 11161 |
| 178 | Ga0466706_052483 | 3300042599 | Bacteria | 38250 |
| 179 | Ga0466707_169476 | 3300042601 | Unclassified | 1633 |
| 180 | Ga0466707_177751 | 3300042601 | Bacteria | 5763 |
| 181 | Ga0466713_013579 | 3300042602 | Bacteria | 17386 |
| 182 | Ga0466713_042396 | 3300042602 | Bacteria | 5051 |
| 183 | Ga0466733_207528 | 3300042659 | Bacteria | 4807 |
| 184 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 185 | Ga0160467_105795 | 3300012829 | Bacteria | 1502 |
| 186 | Ga0466657_327905 | 3300042582 | Bacteria | 7088 |
| 187 | Ga0466691_073144 | 3300042593 | Bacteria | 1390 |
| 188 | Ga0466696_321380 | 3300042596 | Bacteria | 9921 |
| 189 | 2227518252 | 2225789004 | Bacteria | 3392 |
| 190 | 2227652401 | 2225789004 | Bacteria | 10741 |
| 191 | JGI24699J35502_11134170 | 3300002509 | Bacteria | 43760 |
| 192 | Ga0072941_1416120 | 3300005201 | Bacteria | 1766 |
| 193 | Ga0466735_161111 | 3300042624 | Bacteria | 49129 |
| 194 | Ga0466703_229471 | 3300042636 | Bacteria | 11205 |
| 195 | Ga0466708_216050 | 3300042652 | Bacteria | 6342 |
| 196 | Ga0466708_346943 | 3300042652 | Bacteria | 13317 |
| 197 | Ga0466727_299645 | 3300042655 | Bacteria | 13683 |
| 198 | Ga0466711_222762 | 3300042615 | Bacteria | 19993 |
| 199 | Ga0466711_333660 | 3300042615 | Bacteria | 21881 |
| 200 | Ga0466726_387582 | 3300042619 | Bacteria | 2081 |
| 201 | Ga0123354_10244306 | 3300010882 | Unclassified | 1838 |
| 202 | Ga0466701_080575 | 3300042598 | Bacteria | 14163 |
| 203 | Ga0466706_077344 | 3300042599 | Bacteria | 1247 |
| 204 | Ga0466706_130652 | 3300042599 | Bacteria | 9249 |
| 205 | Ga0466713_044401 | 3300042602 | Bacteria | 1185 |
| 206 | Ga0466713_144401 | 3300042602 | Bacteria | 6134 |
| 207 | Ga0466717_134080 | 3300042604 | Bacteria | 3160 |
| 208 | Ga0466733_028364 | 3300042659 | Bacteria | 8040 |
| 209 | Ga0466690_085066 | 3300042590 | Bacteria | 8327 |
| 210 | Ga0466691_123157 | 3300042593 | Bacteria | 15260 |
| 211 | Ga0466695_149938 | 3300042595 | Bacteria | 1530 |
| 212 | Ga0466696_022728 | 3300042596 | Bacteria | 7699 |
| 213 | IMNBGM34_c000646 | 3300000036 | Bacteria | 8549 |
| 214 | IMNBL1DRAFT_c0002803 | 3300000062 | Bacteria | 11788 |
| 215 | IMNBL1DRAFT_c0002999 | 3300000062 | Bacteria | 11189 |
| 216 | IMNBL1DRAFT_c0008209 | 3300000062 | Bacteria | 5352 |
| 217 | Ga0104050_1208831 | 3300007153 | Bacteria | 1048 |
| 218 | Ga0103267_1000033 | 3300007190 | Bacteria | 50825 |
| 219 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 220 | Ga0466735_032446 | 3300042624 | Bacteria | 1061 |
| 221 | Ga0466735_079815 | 3300042624 | Bacteria | 2399 |
| 222 | Ga0466709_026175 | 3300042648 | Bacteria | 31007 |
| 223 | Ga0466708_276024 | 3300042652 | Bacteria | 12596 |
| 224 | Ga0466711_083476 | 3300042615 | Bacteria | 22236 |
| 225 | Ga0466711_446956 | 3300042615 | Bacteria | 32910 |
| 226 | Ga0466723_217392 | 3300042618 | Bacteria | 5095 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01148 | CTP_transf_1 | Cytidylyltransferase family | 7 | 274 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.