Protein Family IF00168
Metagenome
Isolate
139
Members
60
Samples
133
Scaffolds
109.78
Avg Length
Representative Sequence
- ID
- 2225789004|2227646816|2228239282
- Length
- 121 aa
- Sequence
- VKVRHDQPENYLMKYNVLTIPSFDRQLKRLAKKYHSLKAEYVALIEDLEENPQKGTYLGNNCYKIRLALASKGRGKSGGARIITYFYVEEGSVFLLTIYDKSKQTDISDKELRTLLLEIEP
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.4%
Unclassified
13.8%
Kalotermitidae
13.8%
Passalidae
6.9%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Formicidae
1.7%
Hodotermitidae
1.7%
Drosophilidae
1.7%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 43 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 57 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160441_100039 | 3300012825 | Bacteria | 178341 |
| 2 | Ga0466657_083583 | 3300042582 | Bacteria | 6566 |
| 3 | Ga0466695_111369 | 3300042595 | Bacteria | 1176 |
| 4 | Ga0466705_464583 | 3300042612 | Bacteria | 3978 |
| 5 | Ga0466703_157231 | 3300042636 | Bacteria | 3808 |
| 6 | Ga0466703_330317 | 3300042636 | Bacteria | 2573 |
| 7 | Ga0466725_295905 | 3300042654 | Bacteria | 14179 |
| 8 | Ga0466725_395372 | 3300042654 | Bacteria | 4711 |
| 9 | Ga0123356_11277728 | 3300010049 | Unclassified | 898 |
| 10 | Ga0123356_11421266 | 3300010049 | Bacteria | 854 |
| 11 | Ga0123356_11795603 | 3300010049 | Bacteria | 762 |
| 12 | 2227478775 | 2225789004 | Bacteria | 864 |
| 13 | 2227646816 | 2225789004 | Bacteria | 44589 |
| 14 | 2227655183 | 2225789004 | Bacteria | 10646 |
| 15 | IMNBGM34_c002723 | 3300000036 | Bacteria | 2526 |
| 16 | IMNBGM34_c003098 | 3300000036 | Bacteria | 2332 |
| 17 | JGI24702J35022_10147508 | 3300002462 | Bacteria | 1317 |
| 18 | Ga0466697_061281 | 3300042611 | Bacteria | 2126 |
| 19 | Ga0466697_264766 | 3300042611 | Unclassified | 1181 |
| 20 | Ga0466705_154286 | 3300042612 | Bacteria | 18943 |
| 21 | Ga0415639_044649 | 3300038395 | Bacteria | 1314 |
| 22 | Ga0466695_315756 | 3300042595 | Bacteria | 1341 |
| 23 | Ga0466729_261471 | 3300042621 | Bacteria | 3587 |
| 24 | Ga0466731_090553 | 3300042622 | Bacteria | 2347 |
| 25 | Ga0466731_340324 | 3300042622 | Bacteria | 2363 |
| 26 | Ga0466734_121106 | 3300042623 | Bacteria | 2001 |
| 27 | Ga0123356_10369979 | 3300010049 | Bacteria | 1563 |
| 28 | Ga0123353_10136609 | 3300010167 | Unclassified | 3932 |
| 29 | Ga0466713_042241 | 3300042602 | Bacteria | 1186 |
| 30 | JGI24702J35022_10006142 | 3300002462 | Bacteria | 6968 |
| 31 | JGI24705J35276_12178070 | 3300002504 | Bacteria | 1344 |
| 32 | JGI24696J40584_12585796 | 3300002834 | Bacteria | 647 |
| 33 | Ga0068305_10647182 | 3300005083 | Bacteria | 544 |
| 34 | Ga0072941_1372847 | 3300005201 | Bacteria | 1804 |
| 35 | Ga0466693_357494 | 3300042592 | Bacteria | 1209 |
| 36 | Ga0466694_186185 | 3300042594 | Unclassified | 1619 |
| 37 | Ga0466710_366138 | 3300042613 | Bacteria | 1579 |
| 38 | Ga0466731_080797 | 3300042622 | Bacteria | 2513 |
| 39 | Ga0466703_231850 | 3300042636 | Bacteria | 2346 |
| 40 | Ga0466727_004826 | 3300042655 | Bacteria | 1833 |
| 41 | Ga0123357_10040663 | 3300009784 | Bacteria | 6322 |
| 42 | Ga0123356_11048019 | 3300010049 | Bacteria | 985 |
| 43 | Ga0466701_019285 | 3300042598 | Bacteria | 1897 |
| 44 | Ga0466706_122027 | 3300042599 | Bacteria | 1495 |
| 45 | Ga0466706_178842 | 3300042599 | Bacteria | 9088 |
| 46 | Ga0466717_111859 | 3300042604 | Bacteria | 3427 |
| 47 | Ga0466716_216301 | 3300042605 | Bacteria | 1108 |
| 48 | IMNBL1DRAFT_c0156407 | 3300000062 | Bacteria | 583 |
| 49 | Ga0466697_275778 | 3300042611 | Bacteria | 1499 |
| 50 | Ga0466690_117240 | 3300042590 | Bacteria | 2029 |
| 51 | Ga0466690_269362 | 3300042590 | Bacteria | 1720 |
| 52 | Ga0466695_001365 | 3300042595 | Bacteria | 2125 |
| 53 | Ga0466699_085886 | 3300042597 | Bacteria | 2120 |
| 54 | Ga0466710_386706 | 3300042613 | Bacteria | 2064 |
| 55 | Ga0466734_064127 | 3300042623 | Bacteria | 1067 |
| 56 | Ga0466734_074951 | 3300042623 | Bacteria | 1057 |
| 57 | Ga0466734_168639 | 3300042623 | Bacteria | 3303 |
| 58 | Ga0466704_264355 | 3300042643 | Unclassified | 5709 |
| 59 | Ga0466724_13641 | 3300042649 | Bacteria | 4178 |
| 60 | Ga0123356_11561629 | 3300010049 | Unclassified | 816 |
| 61 | Ga0123356_11587225 | 3300010049 | Unclassified | 809 |
| 62 | Ga0123356_13002940 | 3300010049 | Bacteria | 589 |
| 63 | Ga0123353_10003461 | 3300010167 | Bacteria | 19952 |
| 64 | Ga0123353_11611083 | 3300010167 | Bacteria | 819 |
| 65 | Ga0123353_11627882 | 3300010167 | Unclassified | 813 |
| 66 | Ga0466707_057717 | 3300042601 | Bacteria | 10207 |
| 67 | Ga0466698_132569 | 3300042610 | Bacteria | 2634 |
| 68 | JGI24702J35022_10162883 | 3300002462 | Bacteria | 1257 |
| 69 | Ga0105005_1025255 | 3300007505 | Bacteria | 2683 |
| 70 | Ga0466657_039254 | 3300042582 | Bacteria | 1025 |
| 71 | Ga0466710_180219 | 3300042613 | Bacteria | 1744 |
| 72 | Ga0466710_339630 | 3300042613 | Bacteria | 1245 |
| 73 | Ga0466710_432962 | 3300042613 | Bacteria | 1678 |
| 74 | Ga0466728_387540 | 3300042620 | Bacteria | 22543 |
| 75 | Ga0123357_10847025 | 3300009784 | Bacteria | 605 |
| 76 | Ga0123356_10224006 | 3300010049 | Bacteria | 1939 |
| 77 | Ga0123356_10621284 | 3300010049 | Bacteria | 1246 |
| 78 | Ga0123353_10164369 | 3300010167 | Bacteria | 3530 |
| 79 | Ga0466701_024933 | 3300042598 | Bacteria | 1714 |
| 80 | Ga0466713_014382 | 3300042602 | Bacteria | 41830 |
| 81 | Ga0466719_475876 | 3300042606 | Bacteria | 2629 |
| 82 | Ga0466721_266974 | 3300042608 | Bacteria | 1146 |
| 83 | JGI24705J35276_12117695 | 3300002504 | Bacteria | 1063 |
| 84 | JGI24699J35502_11131107 | 3300002509 | Bacteria | 5469 |
| 85 | Ga0466697_130383 | 3300042611 | Bacteria | 1128 |
| 86 | Ga0466732_105341 | 3300042656 | Bacteria | 1002 |
| 87 | Ga0466657_194459 | 3300042582 | Bacteria | 2461 |
| 88 | Ga0466694_038282 | 3300042594 | Bacteria | 1234 |
| 89 | Ga0466725_010481 | 3300042654 | Bacteria | 1209 |
| 90 | Ga0123357_10331692 | 3300009784 | Bacteria | 1485 |
| 91 | Ga0123353_10483695 | 3300010167 | Bacteria | 1810 |
| 92 | Ga0466707_389002 | 3300042601 | Bacteria | 1704 |
| 93 | Ga0466714_046394 | 3300042603 | Bacteria | 1337 |
| 94 | Ga0466717_212954 | 3300042604 | Bacteria | 2416 |
| 95 | Ga0466719_107591 | 3300042606 | Bacteria | 4861 |
| 96 | Ga0466719_402887 | 3300042606 | Bacteria | 3676 |
| 97 | JGI24705J35276_12220046 | 3300002504 | Bacteria | 2242 |
| 98 | JGI24696J40584_12928170 | 3300002834 | Bacteria | 1436 |
| 99 | JGI24696J40584_12942085 | 3300002834 | Unclassified | 1729 |
| 100 | Ga0068302_10139062 | 3300005071 | Bacteria | 1692 |
| 101 | Ga0123357_10001694 | 3300009784 | Bacteria | 23734 |
| 102 | Ga0466657_383153 | 3300042582 | Bacteria | 2430 |
| 103 | Ga0466710_080317 | 3300042613 | Bacteria | 1144 |
| 104 | Ga0466734_096630 | 3300042623 | Bacteria | 2030 |
| 105 | Ga0466702_253771 | 3300042635 | Bacteria | 1180 |
| 106 | Ga0466704_130934 | 3300042643 | Bacteria | 116573 |
| 107 | Ga0466704_177385 | 3300042643 | Bacteria | 2133 |
| 108 | Ga0123357_10073670 | 3300009784 | Bacteria | 4520 |
| 109 | Ga0123356_10558611 | 3300010049 | Bacteria | 1306 |
| 110 | Ga0123356_13401911 | 3300010049 | Bacteria | 552 |
| 111 | Ga0123353_10011198 | 3300010167 | Bacteria | 12616 |
| 112 | Ga0123354_10000084 | 3300010882 | Bacteria | 69544 |
| 113 | Ga0466701_044630 | 3300042598 | Bacteria | 1477 |
| 114 | Ga0466700_008733 | 3300042600 | Bacteria | 4407 |
| 115 | Ga0466720_099225 | 3300042607 | Bacteria | 1236 |
| 116 | Ga0466722_054070 | 3300042609 | Bacteria | 2217 |
| 117 | JGI24702J35022_10225824 | 3300002462 | Bacteria | 1081 |
| 118 | JGI24696J40584_12751923 | 3300002834 | Bacteria | 796 |
| 119 | Ga0466733_103979 | 3300042659 | Bacteria | 2843 |
| 120 | Ga0466656_175908 | 3300042550 | Bacteria | 1240 |
| 121 | Ga0466657_016367 | 3300042582 | Bacteria | 2546 |
| 122 | Ga0466711_305214 | 3300042615 | Bacteria | 1134 |
| 123 | Ga0466704_036478 | 3300042643 | Bacteria | 21164 |
| 124 | Ga0123357_10553988 | 3300009784 | Bacteria | 915 |
| 125 | Ga0123356_11966552 | 3300010049 | Bacteria | 729 |
| 126 | Ga0466700_312391 | 3300042600 | Bacteria | 1264 |
| 127 | Ga0466714_060376 | 3300042603 | Bacteria | 28521 |
| 128 | Ga0466717_111146 | 3300042604 | Bacteria | 1547 |
| 129 | Ga0466717_187193 | 3300042604 | Bacteria | 1121 |
| 130 | Ga0466719_309973 | 3300042606 | Bacteria | 8886 |
| 131 | 2227037875 | 2225789003 | Bacteria | 874 |
| 132 | JGI24705J35276_11613920 | 3300002504 | Bacteria | 596 |
| 133 | Ga0103263_103404 | 3300007042 | Bacteria | 1898 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06296 | RelE | RelE toxin of RelE / RelB toxin-antitoxin system | 25 | 114 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.