Protein Family IF00155
Metagenome
Metatranscriptome
Isolate
242
Members
62
Samples
221
Scaffolds
182.07
Avg Length
Representative Sequence
- ID
- 2225789004|2227510486|2228004084
- Length
- 208 aa
- Sequence
- LWGKKFFSNQPKHTTIIMKSIKGTQTEKNLLTSFAGESQARNRYTYFASAAKKEGFEQIAAIFEETANQEKEHAKRMFKYLEGGMVEITASFPAGVITTTAENLKAAASGEHEEWSLDYPAFADTAEAEGFSDIAAMYRNISIAEKGHEERYLKLLKNIEDCKVFVKEEPVKWQCRNCGFIHEDKNAPESCPACLHPKAYFEEIKTNF
Sample Types
Isolate
8.7%
Metagenome
90.9%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.2%
Unclassified
37.3%
Kalotermitidae
8.5%
Passalidae
1.7%
Termopsidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
1
Bacteria
203
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 3 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 4 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 5 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 6 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 7 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 8 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 9 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 12 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 13 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 22 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 23 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 24 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 3300021228 | Termite gut microbial communities from nest - French Guiana - 23-5 mRNA SA | Metatranscriptome | Termitidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 34 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 45 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 46 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 54 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 60 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_175544 | 3300042656 | Bacteria | 18837 |
| 2 | Ga0466732_424013 | 3300042656 | Bacteria | 1730 |
| 3 | Ga0264413_124686 | 3300024493 | Bacteria | 14459 |
| 4 | Ga0415639_008107 | 3300038395 | Bacteria | 6393 |
| 5 | Ga0415639_044710 | 3300038395 | Bacteria | 7544 |
| 6 | Ga0466699_121605 | 3300042597 | Bacteria | 2537 |
| 7 | Ga0123356_10000271 | 3300010049 | Bacteria | 59375 |
| 8 | Ga0123356_10049061 | 3300010049 | Bacteria | 3930 |
| 9 | Ga0123356_10063971 | 3300010049 | Bacteria | 3438 |
| 10 | Ga0123356_10987730 | 3300010049 | Bacteria | 1012 |
| 11 | Ga0123353_10034248 | 3300010167 | Bacteria | 7924 |
| 12 | Ga0466703_150911 | 3300042636 | Bacteria | 8400 |
| 13 | Ga0466712_014113 | 3300042614 | Bacteria | 9260 |
| 14 | Ga0466712_043487 | 3300042614 | Bacteria | 20906 |
| 15 | Ga0466716_259003 | 3300042605 | Bacteria | 4708 |
| 16 | Ga0466720_106419 | 3300042607 | Bacteria | 5234 |
| 17 | Ga0466698_300294 | 3300042610 | Bacteria | 1010 |
| 18 | AustNasuHG_c1007176 | 3300000089 | Unclassified | 3970 |
| 19 | AustNasuHG_c1008162 | 3300000089 | Bacteria | 3713 |
| 20 | AustNasuHG_c1035950 | 3300000089 | Unclassified | 1294 |
| 21 | FAAS_10002263 | 3300001880 | Bacteria | 2918 |
| 22 | JGI24695J34938_10044484 | 3300002450 | Unclassified | 1974 |
| 23 | Ga0466732_108517 | 3300042656 | Bacteria | 3743 |
| 24 | Ga0466732_109791 | 3300042656 | Unclassified | 1906 |
| 25 | Ga0264413_100793 | 3300024493 | Bacteria | 22082 |
| 26 | Ga0264413_111838 | 3300024493 | Bacteria | 11233 |
| 27 | Ga0466694_375868 | 3300042594 | Bacteria | 5054 |
| 28 | Ga0466699_062083 | 3300042597 | Unclassified | 7007 |
| 29 | Ga0466699_174596 | 3300042597 | Bacteria | 11498 |
| 30 | Ga0466731_167679 | 3300042622 | Bacteria | 1669 |
| 31 | Ga0466735_012058 | 3300042624 | Bacteria | 1810 |
| 32 | Ga0466704_446856 | 3300042643 | Bacteria | 11607 |
| 33 | Ga0466712_119671 | 3300042614 | Bacteria | 15965 |
| 34 | Ga0466712_280907 | 3300042614 | Bacteria | 2600 |
| 35 | Ga0466715_441988 | 3300042616 | Bacteria | 42025 |
| 36 | Ga0466720_101537 | 3300042607 | Bacteria | 24739 |
| 37 | AustNasuHG_c1001875 | 3300000089 | Bacteria | 7588 |
| 38 | JGI24695J34938_10001766 | 3300002450 | Bacteria | 17849 |
| 39 | JGI24695J34938_10002190 | 3300002450 | Bacteria | 15239 |
| 40 | JGI24695J34938_10004728 | 3300002450 | Bacteria | 8814 |
| 41 | JGI24695J34938_10004867 | 3300002450 | Bacteria | 8610 |
| 42 | JGI24695J34938_10019785 | 3300002450 | Bacteria | 3325 |
| 43 | JGI24695J34938_10064488 | 3300002450 | Bacteria | 1550 |
| 44 | Ga0415639_039498 | 3300038395 | Bacteria | 14235 |
| 45 | Ga0415639_116787 | 3300038395 | Bacteria | 3969 |
| 46 | Ga0466694_326007 | 3300042594 | Bacteria | 3631 |
| 47 | Ga0466694_388063 | 3300042594 | Unclassified | 1077 |
| 48 | Ga0466699_009692 | 3300042597 | Bacteria | 1986 |
| 49 | Ga0466699_018066 | 3300042597 | Bacteria | 4483 |
| 50 | Ga0466699_133765 | 3300042597 | Bacteria | 1430 |
| 51 | Ga0466699_295040 | 3300042597 | Bacteria | 23711 |
| 52 | Ga0123357_10167453 | 3300009784 | Bacteria | 2612 |
| 53 | Ga0123356_10000592 | 3300010049 | Bacteria | 40159 |
| 54 | Ga0123353_10344937 | 3300010167 | Bacteria | 2247 |
| 55 | Ga0466735_082792 | 3300042624 | Bacteria | 1158 |
| 56 | Ga0466712_008349 | 3300042614 | Bacteria | 5068 |
| 57 | Ga0466712_011239 | 3300042614 | Unclassified | 1604 |
| 58 | Ga0466712_104072 | 3300042614 | Unclassified | 1317 |
| 59 | Ga0466718_008845 | 3300042617 | Bacteria | 21310 |
| 60 | Ga0466718_093706 | 3300042617 | Bacteria | 4248 |
| 61 | Ga0466718_111800 | 3300042617 | Bacteria | 40150 |
| 62 | Ga0466718_151124 | 3300042617 | Bacteria | 8519 |
| 63 | Ga0466701_047154 | 3300042598 | Archaea | 1773 |
| 64 | Ga0466706_065728 | 3300042599 | Bacteria | 5419 |
| 65 | Ga0466707_276777 | 3300042601 | Bacteria | 7753 |
| 66 | Ga0466720_071105 | 3300042607 | Unclassified | 10069 |
| 67 | Ga0466720_126727 | 3300042607 | Bacteria | 8725 |
| 68 | AustNasuHG_c1022844 | 3300000089 | Bacteria | 2004 |
| 69 | JGI24698J34947_10018886 | 3300002449 | Bacteria | 3722 |
| 70 | JGI24698J34947_10038861 | 3300002449 | Unclassified | 2467 |
| 71 | JGI24695J34938_10003000 | 3300002450 | Bacteria | 12138 |
| 72 | JGI24705J35276_12237436 | 3300002504 | Bacteria | 11139 |
| 73 | Ga0072940_1012483 | 3300005200 | Bacteria | 5568 |
| 74 | Ga0223690_1003382 | 3300021228 | Bacteria | 1243 |
| 75 | Ga0415639_043715 | 3300038395 | Bacteria | 2873 |
| 76 | Ga0466693_137434 | 3300042592 | Bacteria | 55598 |
| 77 | Ga0466693_424545 | 3300042592 | Unclassified | 2721 |
| 78 | Ga0466694_015267 | 3300042594 | Unclassified | 1739 |
| 79 | Ga0466694_312863 | 3300042594 | Bacteria | 2651 |
| 80 | Ga0466699_109377 | 3300042597 | Bacteria | 2345 |
| 81 | Ga0466699_142359 | 3300042597 | Unclassified | 2453 |
| 82 | Ga0466699_231463 | 3300042597 | Bacteria | 1487 |
| 83 | Ga0466699_332200 | 3300042597 | Bacteria | 2513 |
| 84 | Ga0123356_10060900 | 3300010049 | Bacteria | 3523 |
| 85 | Ga0123353_10279273 | 3300010167 | Bacteria | 2566 |
| 86 | Ga0123353_10422106 | 3300010167 | Bacteria | 1976 |
| 87 | Ga0466703_090342 | 3300042636 | Bacteria | 12922 |
| 88 | Ga0466712_062366 | 3300042614 | Bacteria | 14422 |
| 89 | Ga0466712_145657 | 3300042614 | Bacteria | 1821 |
| 90 | Ga0466700_420944 | 3300042600 | Bacteria | 1085 |
| 91 | Ga0466720_023494 | 3300042607 | Unclassified | 1462 |
| 92 | Ga0466720_027911 | 3300042607 | Bacteria | 16141 |
| 93 | Ga0466720_100358 | 3300042607 | Bacteria | 2637 |
| 94 | Nasutiter_Contig11538 | 2030936001 | Bacteria | 3594 |
| 95 | AustNasuHG_c1007192 | 3300000089 | Bacteria | 3964 |
| 96 | AustNasuHG_c1009096 | 3300000089 | Bacteria | 3499 |
| 97 | AustNasuHG_c1021073 | 3300000089 | Unclassified | 2115 |
| 98 | JGI24695J34938_10000388 | 3300002450 | Bacteria | 43510 |
| 99 | JGI24695J34938_10015377 | 3300002450 | Bacteria | 3928 |
| 100 | JGI24695J34938_10045955 | 3300002450 | Bacteria | 1934 |
| 101 | JGI24695J34938_10050230 | 3300002450 | Bacteria | 1830 |
| 102 | JGI24702J35022_10069124 | 3300002462 | Bacteria | 1899 |
| 103 | Ga0068305_10262405 | 3300005083 | Bacteria | 1430 |
| 104 | Ga0072941_1002508 | 3300005201 | Bacteria | 44197 |
| 105 | Ga0074263_119761 | 3300005485 | Unclassified | 848 |
| 106 | Ga0466732_033505 | 3300042656 | Unclassified | 1389 |
| 107 | Ga0466732_119517 | 3300042656 | Bacteria | 2565 |
| 108 | Ga0466732_232494 | 3300042656 | Bacteria | 12096 |
| 109 | Ga0466733_149516 | 3300042659 | Bacteria | 2116 |
| 110 | Ga0415639_088531 | 3300038395 | Unclassified | 3719 |
| 111 | Ga0466694_029380 | 3300042594 | Bacteria | 1076 |
| 112 | Ga0466694_059379 | 3300042594 | Bacteria | 10697 |
| 113 | Ga0466694_212689 | 3300042594 | Bacteria | 44215 |
| 114 | Ga0466699_401695 | 3300042597 | Unclassified | 1024 |
| 115 | Ga0123356_10282142 | 3300010049 | Bacteria | 1757 |
| 116 | Ga0466704_459937 | 3300042643 | Bacteria | 17868 |
| 117 | Ga0466712_042641 | 3300042614 | Bacteria | 6260 |
| 118 | Ga0466712_269306 | 3300042614 | Bacteria | 11332 |
| 119 | Ga0466718_050558 | 3300042617 | Bacteria | 40017 |
| 120 | Ga0466718_161513 | 3300042617 | Unclassified | 1237 |
| 121 | Ga0466706_120528 | 3300042599 | Bacteria | 1333 |
| 122 | Ga0466700_272116 | 3300042600 | Bacteria | 2214 |
| 123 | Ga0466700_428009 | 3300042600 | Bacteria | 2652 |
| 124 | Ga0466720_118379 | 3300042607 | Bacteria | 14999 |
| 125 | JGI24698J34947_10000352 | 3300002449 | Bacteria | 20514 |
| 126 | JGI24695J34938_10001481 | 3300002450 | Bacteria | 19834 |
| 127 | JGI24695J34938_10002342 | 3300002450 | Bacteria | 14601 |
| 128 | JGI24695J34938_10095906 | 3300002450 | Bacteria | 1214 |
| 129 | JGI24695J34938_10160795 | 3300002450 | Unclassified | 923 |
| 130 | JGI24699J35502_11130584 | 3300002509 | Unclassified | 5191 |
| 131 | Ga0466732_186284 | 3300042656 | Bacteria | 12295 |
| 132 | Ga0415639_128531 | 3300038395 | Bacteria | 3104 |
| 133 | Ga0466694_358309 | 3300042594 | Bacteria | 1774 |
| 134 | Ga0466699_050431 | 3300042597 | Bacteria | 39928 |
| 135 | Ga0466699_094678 | 3300042597 | Bacteria | 2999 |
| 136 | Ga0466699_294051 | 3300042597 | Bacteria | 3139 |
| 137 | Ga0466699_297849 | 3300042597 | Bacteria | 1450 |
| 138 | Ga0466699_325966 | 3300042597 | Unclassified | 4385 |
| 139 | Ga0466699_358401 | 3300042597 | Bacteria | 1692 |
| 140 | Ga0123356_10309608 | 3300010049 | Bacteria | 1688 |
| 141 | Ga0123356_12547690 | 3300010049 | Bacteria | 640 |
| 142 | Ga0123353_10471006 | 3300010167 | Bacteria | 1842 |
| 143 | Ga0123353_11718996 | 3300010167 | Unclassified | 785 |
| 144 | Ga0466712_074240 | 3300042614 | Bacteria | 4142 |
| 145 | Ga0466718_059441 | 3300042617 | Bacteria | 3670 |
| 146 | Ga0466718_085336 | 3300042617 | Bacteria | 8696 |
| 147 | Ga0466718_102762 | 3300042617 | Bacteria | 3878 |
| 148 | Ga0466700_203121 | 3300042600 | Bacteria | 1016 |
| 149 | Ga0466714_108252 | 3300042603 | Bacteria | 1083 |
| 150 | Ga0466720_031647 | 3300042607 | Bacteria | 5290 |
| 151 | Ga0466720_178304 | 3300042607 | Unclassified | 1230 |
| 152 | Ga0466720_182190 | 3300042607 | Unclassified | 3758 |
| 153 | AustNasuHG_c1000283 | 3300000089 | Bacteria | 17536 |
| 154 | AustNasuHG_c1020753 | 3300000089 | Bacteria | 2135 |
| 155 | AustNasuHG_c1022511 | 3300000089 | Unclassified | 2023 |
| 156 | JGI24698J34947_10008568 | 3300002449 | Bacteria | 5613 |
| 157 | JGI24698J34947_10055001 | 3300002449 | Bacteria | 1985 |
| 158 | JGI24698J34947_10088627 | 3300002449 | Bacteria | 1427 |
| 159 | JGI24698J34947_10102728 | 3300002449 | Bacteria | 1281 |
| 160 | JGI24698J34947_10168540 | 3300002449 | Unclassified | 889 |
| 161 | JGI24695J34938_10002841 | 3300002450 | Bacteria | 12631 |
| 162 | JGI24695J34938_10008624 | 3300002450 | Bacteria | 5795 |
| 163 | JGI24695J34938_10013394 | 3300002450 | Bacteria | 4310 |
| 164 | JGI24695J34938_10013839 | 3300002450 | Bacteria | 4216 |
| 165 | JGI24695J34938_10077222 | 3300002450 | Bacteria | 1382 |
| 166 | Ga0466732_172407 | 3300042656 | Unclassified | 2660 |
| 167 | Ga0264413_117061 | 3300024493 | Unclassified | 3122 |
| 168 | Ga0466693_141261 | 3300042592 | Bacteria | 9354 |
| 169 | Ga0466694_051314 | 3300042594 | Unclassified | 1057 |
| 170 | Ga0466694_056405 | 3300042594 | Bacteria | 1706 |
| 171 | Ga0466694_065039 | 3300042594 | Bacteria | 5382 |
| 172 | Ga0123356_10009018 | 3300010049 | Bacteria | 9871 |
| 173 | Ga0123353_10791091 | 3300010167 | Bacteria | 1312 |
| 174 | Ga0466704_369819 | 3300042643 | Bacteria | 2122 |
| 175 | Ga0466718_017870 | 3300042617 | Bacteria | 4166 |
| 176 | Ga0466714_093761 | 3300042603 | Bacteria | 1183 |
| 177 | Ga0466720_044395 | 3300042607 | Bacteria | 9561 |
| 178 | Ga0466720_056703 | 3300042607 | Bacteria | 3185 |
| 179 | Ga0466720_093891 | 3300042607 | Bacteria | 26484 |
| 180 | Ga0466720_158071 | 3300042607 | Bacteria | 21754 |
| 181 | Ga0466720_188522 | 3300042607 | Unclassified | 1969 |
| 182 | Ga0466720_235283 | 3300042607 | Unclassified | 2117 |
| 183 | AustNasuHG_c1018199 | 3300000089 | Unclassified | 2323 |
| 184 | AustNasuHG_c1042322 | 3300000089 | Unclassified | 1086 |
| 185 | JGI24698J34947_10027999 | 3300002449 | Bacteria | 2987 |
| 186 | JGI24698J34947_10061310 | 3300002449 | Bacteria | 1852 |
| 187 | JGI24695J34938_10007788 | 3300002450 | Bacteria | 6208 |
| 188 | JGI24695J34938_10047281 | 3300002450 | Bacteria | 1900 |
| 189 | JGI24695J34938_10090217 | 3300002450 | Bacteria | 1258 |
| 190 | JGI24695J34938_10090530 | 3300002450 | Bacteria | 1255 |
| 191 | Ga0466705_279160 | 3300042612 | Bacteria | 7163 |
| 192 | Ga0466732_301334 | 3300042656 | Bacteria | 3647 |
| 193 | Ga0466694_011322 | 3300042594 | Bacteria | 9478 |
| 194 | Ga0466694_073380 | 3300042594 | Bacteria | 10133 |
| 195 | Ga0466694_075104 | 3300042594 | Bacteria | 33181 |
| 196 | Ga0466694_086638 | 3300042594 | Bacteria | 2006 |
| 197 | Ga0123355_10001292 | 3300009826 | Bacteria | 34932 |
| 198 | Ga0123356_10887432 | 3300010049 | Bacteria | 1063 |
| 199 | Ga0123353_10040569 | 3300010167 | Bacteria | 7346 |
| 200 | Ga0466712_161075 | 3300042614 | Bacteria | 15272 |
| 201 | Ga0466718_037177 | 3300042617 | Bacteria | 28595 |
| 202 | Ga0466718_088957 | 3300042617 | Unclassified | 2444 |
| 203 | Ga0466718_110151 | 3300042617 | Bacteria | 5903 |
| 204 | Ga0466714_150452 | 3300042603 | Bacteria | 1207 |
| 205 | Ga0466720_014317 | 3300042607 | Unclassified | 1033 |
| 206 | Ga0466720_045278 | 3300042607 | Bacteria | 12221 |
| 207 | Ga0466720_092256 | 3300042607 | Bacteria | 14355 |
| 208 | Ga0466698_407642 | 3300042610 | Bacteria | 1426 |
| 209 | 2227510486 | 2225789004 | Bacteria | 3566 |
| 210 | AustNasuHG_c1014154 | 3300000089 | Bacteria | 2720 |
| 211 | JGI24698J34947_10004267 | 3300002449 | Bacteria | 7774 |
| 212 | JGI24698J34947_10020212 | 3300002449 | Bacteria | 3589 |
| 213 | JGI24698J34947_10040526 | 3300002449 | Bacteria | 2404 |
| 214 | JGI24698J34947_10050564 | 3300002449 | Unclassified | 2096 |
| 215 | JGI24695J34938_10000721 | 3300002450 | Bacteria | 31222 |
| 216 | JGI24695J34938_10001095 | 3300002450 | Bacteria | 24483 |
| 217 | JGI24695J34938_10007568 | 3300002450 | Bacteria | 6331 |
| 218 | JGI24695J34938_10011837 | 3300002450 | Bacteria | 4669 |
| 219 | JGI24695J34938_10036346 | 3300002450 | Bacteria | 2246 |
| 220 | JGI24695J34938_10113192 | 3300002450 | Bacteria | 1105 |
| 221 | JGI24697J35500_11142592 | 3300002507 | Bacteria | 1315 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00210 | GO:0008199 | ferric iron binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.