Protein Family IF00140
Metagenome
Isolate
164
Members
54
Samples
156
Scaffolds
78.79
Avg Length
Representative Sequence
- ID
- 2225789004|2227226648|2227661461
- Length
- 76 aa
- Sequence
- MEGRQIDKATSDKISFISFIVPAFAEAYKMPIPFKYLKKYGGWDFLNEHWWALHTDNDIWAIHDIYEICYKNGGVR
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.9%
Kalotermitidae
18.5%
Unclassified
16.7%
Rhinotermitidae
5.6%
Termopsidae
3.7%
Passalidae
3.7%
Taxonomy
Archaea
1
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 43 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 50 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 51 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_056060 | 3300042656 | Bacteria | 2000 |
| 2 | 2227219691 | 2225789004 | Bacteria | 7517 |
| 3 | IMNBL1DRAFT_c0024430 | 3300000062 | Bacteria | 2343 |
| 4 | IMNBL1DRAFT_c0062900 | 3300000062 | Bacteria | 1106 |
| 5 | JGI24702J35022_10243315 | 3300002462 | Bacteria | 1044 |
| 6 | JGI24702J35022_10452812 | 3300002462 | Bacteria | 782 |
| 7 | JGI24705J35276_12218373 | 3300002504 | Bacteria | 2141 |
| 8 | Ga0123356_10067729 | 3300010049 | Bacteria | 3344 |
| 9 | Ga0123356_13107910 | 3300010049 | Bacteria | 579 |
| 10 | Ga0123353_10433535 | 3300010167 | Unclassified | 1942 |
| 11 | Ga0123354_10001649 | 3300010882 | Bacteria | 27786 |
| 12 | Ga0466700_309588 | 3300042600 | Bacteria | 264576 |
| 13 | Ga0466690_195816 | 3300042590 | Bacteria | 1810 |
| 14 | Ga0466692_043923 | 3300042591 | Bacteria | 2962 |
| 15 | Ga0466691_021948 | 3300042593 | Bacteria | 25667 |
| 16 | Ga0466699_334397 | 3300042597 | Unclassified | 1064 |
| 17 | Ga0466726_080294 | 3300042619 | Archaea | 3975 |
| 18 | Ga0466731_000737 | 3300042622 | Bacteria | 3496 |
| 19 | Ga0466724_63228 | 3300042649 | Bacteria | 3841 |
| 20 | Ga0466732_441409 | 3300042656 | Bacteria | 1565 |
| 21 | Ga0466733_132946 | 3300042659 | Bacteria | 5748 |
| 22 | IMNBL1DRAFT_c0022723 | 3300000062 | Bacteria | 2474 |
| 23 | IMNBL1DRAFT_c0043381 | 3300000062 | Bacteria | 1489 |
| 24 | JGI24696J40584_12946058 | 3300002834 | Unclassified | 1880 |
| 25 | Ga0123357_10920829 | 3300009784 | Bacteria | 560 |
| 26 | Ga0123353_10277759 | 3300010167 | Bacteria | 2575 |
| 27 | Ga0123353_10939954 | 3300010167 | Unclassified | 1171 |
| 28 | Ga0123354_10126615 | 3300010882 | Bacteria | 3258 |
| 29 | Ga0123354_10435987 | 3300010882 | Unclassified | 1075 |
| 30 | Ga0466714_114622 | 3300042603 | Bacteria | 1721 |
| 31 | Ga0466720_122752 | 3300042607 | Bacteria | 2052 |
| 32 | Ga0466722_080343 | 3300042609 | Bacteria | 16839 |
| 33 | Ga0466698_248314 | 3300042610 | Unclassified | 1091 |
| 34 | Ga0466698_341758 | 3300042610 | Bacteria | 1287 |
| 35 | Ga0466694_217935 | 3300042594 | Unclassified | 1027 |
| 36 | Ga0466696_312848 | 3300042596 | Unclassified | 1230 |
| 37 | Ga0466729_106334 | 3300042621 | Bacteria | 1436 |
| 38 | Ga0466731_063916 | 3300042622 | Bacteria | 1203 |
| 39 | Ga0466703_256509 | 3300042636 | Bacteria | 3956 |
| 40 | 2227206920 | 2225789004 | Unclassified | 1423 |
| 41 | IMNBL1DRAFT_c0014330 | 3300000062 | Bacteria | 3505 |
| 42 | IMNBL1DRAFT_c0017503 | 3300000062 | Unclassified | 3014 |
| 43 | IMNBL1DRAFT_c0070556 | 3300000062 | Bacteria | 1010 |
| 44 | JGI24702J35022_10003812 | 3300002462 | Bacteria | 9047 |
| 45 | JGI24696J40584_12864991 | 3300002834 | Bacteria | 1025 |
| 46 | Ga0123355_10000242 | 3300009826 | Bacteria | 70195 |
| 47 | Ga0123356_11636075 | 3300010049 | Bacteria | 798 |
| 48 | Ga0466719_181310 | 3300042606 | Unclassified | 1018 |
| 49 | Ga0415639_194964 | 3300038395 | Bacteria | 2042 |
| 50 | Ga0466657_065687 | 3300042582 | Bacteria | 3412 |
| 51 | Ga0466691_075177 | 3300042593 | Bacteria | 26045 |
| 52 | Ga0466691_077113 | 3300042593 | Bacteria | 29256 |
| 53 | Ga0466694_119890 | 3300042594 | Bacteria | 2062 |
| 54 | Ga0466712_289297 | 3300042614 | Bacteria | 1385 |
| 55 | Ga0466709_064425 | 3300042648 | Bacteria | 43572 |
| 56 | Ga0466733_014817 | 3300042659 | Bacteria | 2239 |
| 57 | IMNBL1DRAFT_c0007042 | 3300000062 | Bacteria | 5993 |
| 58 | JGI24696J40584_12609036 | 3300002834 | Bacteria | 663 |
| 59 | JGI24696J40584_12882847 | 3300002834 | Bacteria | 1092 |
| 60 | JGI24696J40584_12904682 | 3300002834 | Bacteria | 1209 |
| 61 | JGI24696J40584_12936287 | 3300002834 | Bacteria | 1577 |
| 62 | Ga0123357_10047766 | 3300009784 | Bacteria | 5801 |
| 63 | Ga0123357_10388649 | 3300009784 | Bacteria | 1285 |
| 64 | Ga0123353_10785800 | 3300010167 | Bacteria | 1317 |
| 65 | Ga0123353_10935045 | 3300010167 | Bacteria | 1175 |
| 66 | Ga0466707_053362 | 3300042601 | Bacteria | 22799 |
| 67 | Ga0466693_079792 | 3300042592 | Bacteria | 4480 |
| 68 | Ga0466691_060892 | 3300042593 | Bacteria | 5521 |
| 69 | Ga0466697_168511 | 3300042611 | Bacteria | 1189 |
| 70 | Ga0466710_322096 | 3300042613 | Bacteria | 1261 |
| 71 | Ga0466711_324273 | 3300042615 | Bacteria | 1011 |
| 72 | Ga0466711_435871 | 3300042615 | Bacteria | 2616 |
| 73 | Ga0466729_115246 | 3300042621 | Unclassified | 1538 |
| 74 | Ga0466703_081490 | 3300042636 | Bacteria | 1656 |
| 75 | Ga0466709_035200 | 3300042648 | Bacteria | 1572 |
| 76 | Ga0466709_092725 | 3300042648 | Bacteria | 4700 |
| 77 | Ga0466724_55836 | 3300042649 | Bacteria | 1636 |
| 78 | Ga0466725_267298 | 3300042654 | Bacteria | 11477 |
| 79 | 2227226648 | 2225789004 | Bacteria | 1375 |
| 80 | Ga0123355_10000533 | 3300009826 | Bacteria | 50893 |
| 81 | Ga0123356_10179852 | 3300010049 | Unclassified | 2136 |
| 82 | Ga0123353_11130968 | 3300010167 | Unclassified | 1036 |
| 83 | Ga0123353_11640577 | 3300010167 | Bacteria | 809 |
| 84 | Ga0123353_12128914 | 3300010167 | Bacteria | 682 |
| 85 | Ga0123354_10105532 | 3300010882 | Bacteria | 3769 |
| 86 | Ga0466700_188545 | 3300042600 | Bacteria | 1927 |
| 87 | Ga0466714_011122 | 3300042603 | Bacteria | 3612 |
| 88 | Ga0466716_187693 | 3300042605 | Bacteria | 1313 |
| 89 | Ga0466656_144242 | 3300042550 | Bacteria | 1136 |
| 90 | Ga0466693_227863 | 3300042592 | Bacteria | 3679 |
| 91 | Ga0466691_135808 | 3300042593 | Bacteria | 2062 |
| 92 | Ga0466694_103377 | 3300042594 | Bacteria | 1300 |
| 93 | Ga0466694_239713 | 3300042594 | Bacteria | 1017 |
| 94 | Ga0466711_185234 | 3300042615 | Bacteria | 2827 |
| 95 | Ga0466711_446086 | 3300042615 | Bacteria | 1409 |
| 96 | Ga0466703_038583 | 3300042636 | Unclassified | 3540 |
| 97 | Ga0466704_423827 | 3300042643 | Bacteria | 1651 |
| 98 | 2227481595 | 2225789004 | Bacteria | 4417 |
| 99 | 2227637119 | 2225789004 | Bacteria | 2083 |
| 100 | IMNBL1DRAFT_c0000206 | 3300000062 | Bacteria | 51916 |
| 101 | IMNBL1DRAFT_c0000218 | 3300000062 | Bacteria | 50480 |
| 102 | IMNBL1DRAFT_c0019169 | 3300000062 | Bacteria | 2813 |
| 103 | JGI24702J35022_10039367 | 3300002462 | Bacteria | 2522 |
| 104 | JGI24696J40584_12459794 | 3300002834 | Bacteria | 580 |
| 105 | Ga0072940_1183835 | 3300005200 | Bacteria | 733 |
| 106 | Ga0123354_10174470 | 3300010882 | Bacteria | 2485 |
| 107 | Ga0123354_10218569 | 3300010882 | Bacteria | 2033 |
| 108 | Ga0466656_023557 | 3300042550 | Bacteria | 1149 |
| 109 | Ga0466657_067503 | 3300042582 | Bacteria | 1038 |
| 110 | Ga0466657_311002 | 3300042582 | Bacteria | 1305 |
| 111 | Ga0466693_266818 | 3300042592 | Unclassified | 1027 |
| 112 | Ga0466697_098905 | 3300042611 | Bacteria | 2182 |
| 113 | Ga0466697_134912 | 3300042611 | Bacteria | 1488 |
| 114 | Ga0466729_050961 | 3300042621 | Bacteria | 1745 |
| 115 | Ga0466708_361487 | 3300042652 | Bacteria | 4560 |
| 116 | Ga0466725_324598 | 3300042654 | Bacteria | 1487 |
| 117 | 2227166937 | 2225789004 | Bacteria | 8265 |
| 118 | 2227505861 | 2225789004 | Unclassified | 720 |
| 119 | 2227521350 | 2225789004 | Unclassified | 662 |
| 120 | IMNBL1DRAFT_c0052156 | 3300000062 | Unclassified | 1283 |
| 121 | IMNBL1DRAFT_c0087814 | 3300000062 | Bacteria | 858 |
| 122 | JGI24702J35022_10600641 | 3300002462 | Bacteria | 681 |
| 123 | JGI24705J35276_12232988 | 3300002504 | Bacteria | 4604 |
| 124 | Ga0068302_10066918 | 3300005071 | Bacteria | 9116 |
| 125 | Ga0123356_10781809 | 3300010049 | Bacteria | 1125 |
| 126 | Ga0123356_11329807 | 3300010049 | Unclassified | 881 |
| 127 | Ga0123353_10086326 | 3300010167 | Unclassified | 5053 |
| 128 | Ga0123354_10358767 | 3300010882 | Unclassified | 1288 |
| 129 | Ga0123354_10648418 | 3300010882 | Unclassified | 755 |
| 130 | Ga0466716_044743 | 3300042605 | Bacteria | 6810 |
| 131 | Ga0466657_172699 | 3300042582 | Bacteria | 1344 |
| 132 | Ga0466692_017761 | 3300042591 | Bacteria | 14021 |
| 133 | Ga0466693_170493 | 3300042592 | Bacteria | 3398 |
| 134 | Ga0466697_066161 | 3300042611 | Bacteria | 1346 |
| 135 | Ga0466711_252001 | 3300042615 | Bacteria | 1969 |
| 136 | Ga0466734_165774 | 3300042623 | Bacteria | 2748 |
| 137 | Ga0466703_165272 | 3300042636 | Bacteria | 3549 |
| 138 | Ga0466725_177993 | 3300042654 | Bacteria | 1652 |
| 139 | 2227560456 | 2225789004 | Bacteria | 2729 |
| 140 | 2227649622 | 2225789004 | Bacteria | 10818 |
| 141 | IMNBL1DRAFT_c0001231 | 3300000062 | Bacteria | 19329 |
| 142 | IMNBL1DRAFT_c0045994 | 3300000062 | Bacteria | 1420 |
| 143 | JGI24705J35276_12189607 | 3300002504 | Bacteria | 1453 |
| 144 | Ga0123356_10043058 | 3300010049 | Bacteria | 4204 |
| 145 | Ga0123353_10009327 | 3300010167 | Bacteria | 13528 |
| 146 | Ga0123353_10049282 | 3300010167 | Bacteria | 6709 |
| 147 | Ga0123353_10435471 | 3300010167 | Bacteria | 1936 |
| 148 | Ga0123354_10340407 | 3300010882 | Unclassified | 1353 |
| 149 | Ga0466707_055464 | 3300042601 | Bacteria | 6977 |
| 150 | Ga0466707_344637 | 3300042601 | Bacteria | 4639 |
| 151 | Ga0466714_089083 | 3300042603 | Bacteria | 1545 |
| 152 | Ga0466722_053071 | 3300042609 | Bacteria | 1225 |
| 153 | Ga0466656_337827 | 3300042550 | Bacteria | 1850 |
| 154 | Ga0466712_204921 | 3300042614 | Bacteria | 1994 |
| 155 | Ga0466711_166303 | 3300042615 | Bacteria | 4191 |
| 156 | Ga0466704_159613 | 3300042643 | Bacteria | 1720 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12668 | DUF3791 | Protein of unknown function (DUF3791) | 16 | 71 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.