Protein Family IF00132

Metagenome Metatranscriptome Isolate
249 Members
100 Samples
186 Scaffolds
239.15 Avg Length

🧬 Representative Sequence

ID
2225789004|2227080788|2227453833
Length
276 aa
Sequence
MLLRNVNYCKQLKILVKLSVSLFIIYTITVKIVRIRGKEMSGHSKFANIKHKKERNDAAKGKVFTVIGREIAVAVKDAGADPANNSRLRDIIAKAKANNMPNDTIDRGIKKAAGDLSAVNYETVTYEGYGPNGVAIIVDALTDNKNRTASNVRNAFTKGNGNVGTQGCVSFMFDKKGQIIIDKEACDIDADSLMMLALDAGAEDFAEEDESFEIITEPEIFGEVREALENAGVAMIEAEVTMIPQTWTELTDDEDIKRMNKTLLLDVQAVYHNWNE

📊 Sample Types

Isolate 25.3%
Metagenome 74.3%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 49.5%
Termitidae 21.2%
Blattidae 14.1%
Kalotermitidae 6.1%
Passalidae 3.0%
Termopsidae 2.0%
Hodotermitidae 1.0%
Rhinotermitidae 1.0%
Scarabaeidae 1.0%
Tenebrionidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 241
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
2 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
3 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
4 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
5 2590828839 Clostridium sp. 1 Isolate Termitidae
6 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
7 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
8 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
9 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
19 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
20 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
21 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
22 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
23 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
24 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
25 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
26 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
27 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
28 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
33 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
34 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
35 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
36 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
37 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
38 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
39 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
40 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
48 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
49 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
50 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
51 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
52 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
53 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
54 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
55 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
56 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
57 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
58 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
59 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
60 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
61 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
62 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
63 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
66 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
67 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
68 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
70 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
71 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
72 3300021192 Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA Metatranscriptome Termitidae
73 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
74 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
75 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
76 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
77 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
78 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
79 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
80 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
81 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
82 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
83 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
84 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
85 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
86 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
87 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
88 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
89 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
90 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
91 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
92 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
93 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
94 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
95 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
96 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
97 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
98 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
99 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
100 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_173934 3300042612 Bacteria 7222
2 Ga0466733_144102 3300042659 Bacteria 37735
3 Ga0466733_195694 3300042659 Bacteria 5471
4 Ga0466733_205193 3300042659 Bacteria 1098
5 Ga0123355_10000014 3300009826 Bacteria 174606
6 Ga0123355_10000768 3300009826 Bacteria 43811
7 Ga0123355_10008241 3300009826 Bacteria 15743
8 Ga0123355_10021863 3300009826 Bacteria 10247
9 Ga0123355_10028391 3300009826 Bacteria 9047
10 Ga0123355_10124399 3300009826 Bacteria 3990
11 Ga0123355_10155092 3300009826 Bacteria 3467
12 Ga0123355_10238682 3300009826 Bacteria 2580
13 Ga0123355_10271442 3300009826 Bacteria 2355
14 Ga0123353_10169946 3300010167 Bacteria 3462
15 Ga0123353_10194068 3300010167 Bacteria 3202
16 Ga0466706_038679 3300042599 Bacteria 8289
17 Ga0466706_102400 3300042599 Bacteria 3676
18 Ga0466713_012340 3300042602 Bacteria 3661
19 Ga0466713_146026 3300042602 Bacteria 12303
20 Ga0466716_236689 3300042605 Bacteria 1967
21 Ga0466697_054625 3300042611 Bacteria 1224
22 Ga0415639_194628 3300038395 Bacteria 1596
23 Ga0466709_409920 3300042648 Bacteria 51090
24 Ga0466725_367690 3300042654 Bacteria 3749
25 Ga0466725_412238 3300042654 Bacteria 2595
26 Ga0466715_179055 3300042616 Bacteria 62432
27 Ga0466715_437280 3300042616 Bacteria 6203
28 Ga0466726_384743 3300042619 Bacteria 21953
29 IMNBL1DRAFT_c0001135 3300000062 Bacteria 20366
30 JGI24695J34938_10001265 3300002450 Bacteria 22212
31 JGI24695J34938_10008730 3300002450 Bacteria 5744
32 Ga0123355_10003039 3300009826 Bacteria 23900
33 Ga0123355_10008084 3300009826 Bacteria 15868
34 Ga0123355_10013571 3300009826 Bacteria 12690
35 Ga0123355_10105569 3300009826 Bacteria 4420
36 Ga0123355_10151511 3300009826 Bacteria 3522
37 Ga0123355_10238909 3300009826 Bacteria 2578
38 Ga0123355_10541033 3300009826 Bacteria 1413
39 Ga0123356_10156151 3300010049 Bacteria 2272
40 Ga0123356_10300428 3300010049 Bacteria 1710
41 Ga0123353_10000107 3300010167 Bacteria 96760
42 Ga0123353_10034469 3300010167 Bacteria 7900
43 Ga0123353_10095255 3300010167 Bacteria 4796
44 Ga0123353_10390013 3300010167 Bacteria 2078
45 Ga0123353_10607664 3300010167 Bacteria 1561
46 Ga0123353_11140720 3300010167 Bacteria 1030
47 Ga0466706_034356 3300042599 Bacteria 8493
48 Ga0466706_256855 3300042599 Unclassified 3434
49 Ga0415639_000074 3300038395 Bacteria 109555
50 Ga0415639_008116 3300038395 Bacteria 21324
51 Ga0466694_399878 3300042594 Bacteria 1121
52 Ga0466703_323622 3300042636 Bacteria 7662
53 Ga0466724_21417 3300042649 Bacteria 3502
54 Ga0466724_47147 3300042649 Bacteria 5732
55 Ga0466725_077608 3300042654 Bacteria 7654
56 Ga0466725_295248 3300042654 Bacteria 3713
57 Ga0466715_545145 3300042616 Bacteria 3585
58 2226988720 2225789003 Bacteria 7434
59 2227136412 2225789004 Bacteria 1639
60 IMNBL1DRAFT_c0000006 3300000062 Bacteria 247403
61 JGI24705J35276_12235778 3300002504 Bacteria 6971
62 Ga0072941_1060665 3300005201 Bacteria 11978
63 Ga0466733_045323 3300042659 Bacteria 1706
64 Ga0123355_10005045 3300009826 Bacteria 19233
65 Ga0123355_10146261 3300009826 Bacteria 3603
66 Ga0123355_10287851 3300009826 Bacteria 2259
67 Ga0123355_10353622 3300009826 Bacteria 1943
68 Ga0123355_10722120 3300009826 Bacteria 1136
69 Ga0123356_10125371 3300010049 Bacteria 2505
70 Ga0123353_10378766 3300010167 Bacteria 2117
71 Ga0123353_10459546 3300010167 Unclassified 1871
72 Ga0123353_11339117 3300010167 Bacteria 926
73 Ga0466706_009084 3300042599 Bacteria 5566
74 Ga0466706_266797 3300042599 Bacteria 5326
75 Ga0466707_086086 3300042601 Bacteria 11648
76 Ga0466713_061400 3300042602 Bacteria 32149
77 Ga0466714_003429 3300042603 Bacteria 10291
78 Ga0466714_140082 3300042603 Bacteria 1816
79 Ga0466704_243603 3300042643 Bacteria 5412
80 Ga0466725_229149 3300042654 Bacteria 1940
81 Ga0466726_100199 3300042619 Bacteria 28393
82 Ga0466726_479324 3300042619 Bacteria 1769
83 IMNBL1DRAFT_c0023153 3300000062 Bacteria 2441
84 JGI24703J35330_11748035 3300002501 Bacteria 10070
85 JGI24703J35330_11748611 3300002501 Bacteria 22015
86 Ga0562377_0006 3300056842 Bacteria 3350072
87 Ga0123357_10104403 3300009784 Bacteria 3639
88 Ga0123357_10547070 3300009784 Bacteria 926
89 Ga0123355_10001080 3300009826 Bacteria 37628
90 Ga0123355_10011997 3300009826 Bacteria 13398
91 Ga0123355_10022414 3300009826 Bacteria 10125
92 Ga0123355_10056065 3300009826 Unclassified 6379
93 Ga0123355_10069085 3300009826 Bacteria 5680
94 Ga0123356_10087109 3300010049 Bacteria 2966
95 Ga0123356_10162609 3300010049 Bacteria 2232
96 Ga0123356_10696982 3300010049 Bacteria 1184
97 Ga0123356_11495934 3300010049 Bacteria 833
98 Ga0123353_10038723 3300010167 Bacteria 7497
99 Ga0466706_111035 3300042599 Bacteria 57203
100 Ga0466714_126471 3300042603 Bacteria 15352
101 Ga0466693_018546 3300042592 Unclassified 4039
102 Ga0466694_210319 3300042594 Bacteria 1352
103 Ga0466704_384573 3300042643 Unclassified 3615
104 Ga0466725_009950 3300042654 Bacteria 52916
105 Ga0466715_483797 3300042616 Bacteria 58432
106 2227080788 2225789004 Bacteria 142057
107 IMNBL1DRAFT_c0001883 3300000062 Bacteria 15269
108 IMNBL1DRAFT_c0009505 3300000062 Bacteria 4791
109 Ga0072941_1282139 3300005201 Bacteria 5425
110 Ga0123357_10356451 3300009784 Bacteria 1391
111 Ga0123355_10000001 3300009826 Bacteria 286680
112 Ga0123355_10000073 3300009826 Bacteria 107394
113 Ga0123355_10000311 3300009826 Bacteria 62673
114 Ga0123355_10000853 3300009826 Bacteria 42039
115 Ga0123355_10001032 3300009826 Bacteria 38573
116 Ga0123355_10001826 3300009826 Bacteria 29793
117 Ga0123355_10012794 3300009826 Bacteria 13019
118 Ga0123355_10145034 3300009826 Bacteria 3622
119 Ga0123355_10323222 3300009826 Bacteria 2076
120 Ga0123355_10751948 3300009826 Bacteria 1102
121 Ga0466706_016465 3300042599 Unclassified 10574
122 Ga0466706_029400 3300042599 Unclassified 4726
123 Ga0466706_209041 3300042599 Bacteria 4831
124 Ga0466713_112205 3300042602 Bacteria 1913
125 Ga0466714_089141 3300042603 Bacteria 17915
126 Ga0466702_393403 3300042635 Bacteria 6909
127 Ga0466709_368918 3300042648 Bacteria 82197
128 Ga0466725_430999 3300042654 Bacteria 7262
129 IMNBL1DRAFT_c0000359 3300000062 Bacteria 38654
130 IMNBL1DRAFT_c0006721 3300000062 Bacteria 6224
131 Ga0072941_1000016 3300005201 Bacteria 165423
132 Ga0072941_1691140 3300005201 Bacteria 1292
133 Ga0123355_10003464 3300009826 Bacteria 22612
134 Ga0123355_10086385 3300009826 Bacteria 4989
135 Ga0123355_10101670 3300009826 Bacteria 4522
136 Ga0123355_10213493 3300009826 Bacteria 2791
137 Ga0123355_10256685 3300009826 Bacteria 2452
138 Ga0123355_10263306 3300009826 Bacteria 2408
139 Ga0123355_10287811 3300009826 Bacteria 2259
140 Ga0123355_11023424 3300009826 Bacteria 873
141 Ga0123353_10333174 3300010167 Bacteria 2296
142 Ga0466707_163801 3300042601 Bacteria 828024
143 Ga0415639_048780 3300038395 Bacteria 5902
144 Ga0466735_068015 3300042624 Bacteria 1361
145 Ga0466726_285064 3300042619 Bacteria 19906
146 JGI24703J35330_11680994 3300002501 Bacteria 1810
147 JGI24703J35330_11748723 3300002501 Bacteria 29129
148 Ga0068305_10002674 3300005083 Unclassified 12745
149 Ga0123355_10001981 3300009826 Bacteria 28905
150 Ga0123355_10060760 3300009826 Bacteria 6102
151 Ga0123355_10101184 3300009826 Bacteria 4537
152 Ga0123355_10202514 3300009826 Bacteria 2896
153 Ga0123355_10331263 3300009826 Bacteria 2039
154 Ga0123355_10581083 3300009826 Bacteria 1339
155 Ga0123356_10745596 3300010049 Bacteria 1149
156 Ga0123353_10000009 3300010167 Bacteria 250725
157 Ga0123353_10491171 3300010167 Bacteria 1792
158 Ga0123353_10503765 3300010167 Bacteria 1763
159 Ga0123354_10181158 3300010882 Bacteria 2404
160 Ga0123354_10312122 3300010882 Bacteria 1466
161 Ga0466706_114731 3300042599 Bacteria 2327
162 Ga0466714_130156 3300042603 Bacteria 1243
163 Ga0222432_1000229 3300021192 Bacteria 1037
164 Ga0415639_006762 3300038395 Bacteria 14548
165 IMNBL1DRAFT_c0000028 3300000062 Bacteria 135353
166 JGI24695J34938_10000463 3300002450 Bacteria 39502
167 JGI24697J35500_11274963 3300002507 Bacteria 28413
168 Ga0466705_175858 3300042612 Bacteria 9125
169 Ga0466705_206372 3300042612 Bacteria 41856
170 Ga0123355_10004356 3300009826 Bacteria 20581
171 Ga0123355_10219240 3300009826 Bacteria 2740
172 Ga0123355_10298603 3300009826 Bacteria 2199
173 Ga0123355_10644006 3300009826 Bacteria 1239
174 Ga0123355_10840271 3300009826 Bacteria 1013
175 Ga0123353_10197206 3300010167 Bacteria 3172
176 Ga0123354_10044151 3300010882 Bacteria 6840
177 Ga0123354_10172103 3300010882 Bacteria 2514
178 Ga0466706_006259 3300042599 Bacteria 1314
179 Ga0466713_138385 3300042602 Bacteria 336961
180 Ga0466722_165443 3300042609 Bacteria 1954
181 Ga0466703_342141 3300042636 Bacteria 1527
182 Ga0466704_576960 3300042643 Bacteria 1953
183 Ga0466725_126010 3300042654 Bacteria 1777
184 Ga0466725_374477 3300042654 Bacteria 10314
185 2227100258 2225789004 Bacteria 9607
186 JGI24705J35276_12238626 3300002504 Bacteria 30277

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20772 TACO1_YebC_N TACO1/YebC protein N-terminal domain 44 114 0.98
PF01709 Transcrip_reg TACO1/YebC second and third domain 121 274 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.