NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017262

3300017262: Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)



Overview

Basic Information
IMG/M Taxon OID3300017262 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0211932 | Ga0186220
Sample NameMetatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31610624
Sequencing Scaffolds11
Novel Protein Genes11
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea7
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine tidal flow zone → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationTyrrhenian Sea
CoordinatesLat. (o)38.54Long. (o)8.46Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009809Metagenome / Metatranscriptome312Y
F011523Metagenome / Metatranscriptome290Y
F022421Metagenome / Metatranscriptome214Y
F034341Metagenome / Metatranscriptome175Y
F039667Metagenome / Metatranscriptome163Y
F040117Metagenome / Metatranscriptome162Y
F044532Metagenome / Metatranscriptome154Y
F052624Metagenome / Metatranscriptome142Y
F062157Metagenome / Metatranscriptome131Y
F077340Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186220_100002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae18533Open in IMG/M
Ga0186220_104373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1827Open in IMG/M
Ga0186220_108485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1244Open in IMG/M
Ga0186220_110840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1020Open in IMG/M
Ga0186220_111569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea961Open in IMG/M
Ga0186220_113866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea793Open in IMG/M
Ga0186220_114055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea779Open in IMG/M
Ga0186220_114655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
Ga0186220_116395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae636Open in IMG/M
Ga0186220_117069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae599Open in IMG/M
Ga0186220_118373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186220_100002Ga0186220_1000021F062157LILEYDFITHCIDSKIESMVLIDSYVKKNEIRLNTFEYLLKNNEHTLKHQFVKSNFMEKMFSDYIQDFREFNIQFSKIDLEFLAFRKTFPIRLESISILNTTLLEKERAPAVFTELIMYARRHFLIRNEVAMLRLGKLSNKESTSLLLFSIILESNQEDLIYAMMQEGVHKTIKDMMKEYPSLNKRYPILAQFINKY
Ga0186220_104373Ga0186220_1043733F034341MDIYSDDMTFNTFYEQKKKDLKILSALNEFVKPNPYFIYYMFKDTIHVDDYGSIKETHFKFPSMNKS
Ga0186220_108485Ga0186220_1084851F022421VFYLSQKFYRWLRWQDGTHLMLADKSEAGWYFVPDRGYDLVTNTISGEYTPEHVHHNYLYTDAYEKSRQARGKEGASHGQFLPSGQFSPKDKWF
Ga0186220_110840Ga0186220_1108401F039667MAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRSLARIFKRMDFNGNKKLDA
Ga0186220_111569Ga0186220_1115692F044532NNFYSSNFPEYMWQKPHYDLGNKMIHSDLYKKLNPIRGRYDYKPNDYSQMPYFLGHVPQFTWIYGNLDYSFNKYHRHY
Ga0186220_113866Ga0186220_1138661F011523NMTEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIARSLARDTDGDFTKFVTTTGKPRDNAQRWRAFKNIARFYKNPFGYTYWKMQPLHTENRVRVIWALLFYHLYQSFLLYILIKDKKEGMIAKWRYVLGESNKVYDAPHKDRRFPVDRKKNYVRYSNFHQVRRNKRISMMWTNWWCRDQNFRKYFEMRKKNGIRPSYTGFYHEKIYKETA
Ga0186220_114055Ga0186220_1140552F009809LEKIDDCDEETFRDAKSIIELLKENLSLWKEDEEDNKGEDN
Ga0186220_114655Ga0186220_1146551F009809MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEENQNADDQ
Ga0186220_116395Ga0186220_1163951F052624MIYANYITKEMYVFDKEGEWHDEGIYHDALSLDKTFSEKNWYDEFSPSHFXPFQLLFKS
Ga0186220_117069Ga0186220_1170691F077340MVFHITNYMRETNVWMIRKGRWLLWGMVLSIPIYRNVYWDFLGRRVALKQWLYGGSEEEQRKRAEA
Ga0186220_118373Ga0186220_1183731F040117MPQLFFLVVSYLLTPAYRRLDERYHLRFADGEGDDIDEVETFVTYHQRKKPLTRKKYSDAVKLIYKGEEEYDYIPEQPIRYR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.