NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009809

Metagenome / Metatranscriptome Family F009809

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009809
Family Type Metagenome / Metatranscriptome
Number of Sequences 312
Average Sequence Length 42 residues
Representative Sequence MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL
Number of Associated Samples 209
Number of Associated Scaffolds 312

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 57.88 %
% of genes near scaffold ends (potentially truncated) 24.68 %
% of genes from short scaffolds (< 2000 bps) 99.68 %
Associated GOLD sequencing projects 195
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.064 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.526 % of family members)
Environment Ontology (ENVO) Unclassified
(24.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.949 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 312 Family Scaffolds
PF0024414-3-3 84.62
PF01058Oxidored_q6 0.32
PF07159CYRIA-B_Rac1-bd 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 312 Family Scaffolds
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.32
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.32
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.32
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.32

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.06 %
UnclassifiedrootN/A9.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002039|LBB32012_10074122All Organisms → cellular organisms → Eukaryota990Open in IMG/M
3300002161|JGI24766J26685_10108313All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Nidulantes → Aspergillus nidulans589Open in IMG/M
3300002186|JGI24539J26755_10230405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300004112|Ga0065166_10156608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300004463|Ga0063356_102284909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea825Open in IMG/M
3300004463|Ga0063356_104051974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300004769|Ga0007748_10003010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300004769|Ga0007748_11668034All Organisms → cellular organisms → Eukaryota1036Open in IMG/M
3300004795|Ga0007756_11539861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300004807|Ga0007809_10111491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea827Open in IMG/M
3300005418|Ga0068881_1341998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea709Open in IMG/M
3300005418|Ga0068881_1416055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea897Open in IMG/M
3300005662|Ga0078894_10732836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata870Open in IMG/M
3300005662|Ga0078894_11587748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300006107|Ga0007836_1134419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila529Open in IMG/M
3300006107|Ga0007836_1139487Not Available518Open in IMG/M
3300006415|Ga0099654_10066233All Organisms → cellular organisms → Eukaryota799Open in IMG/M
3300006803|Ga0075467_10220419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1044Open in IMG/M
3300006803|Ga0075467_10662139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300006805|Ga0075464_11070062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila508Open in IMG/M
3300007230|Ga0075179_1636172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea798Open in IMG/M
3300007230|Ga0075179_1637674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300007319|Ga0102691_1427590All Organisms → cellular organisms → Eukaryota699Open in IMG/M
3300007516|Ga0105050_10383472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea845Open in IMG/M
3300007558|Ga0102822_1047951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1014Open in IMG/M
3300007665|Ga0102908_1122955Not Available532Open in IMG/M
3300007725|Ga0102951_1080661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300007725|Ga0102951_1244489All Organisms → cellular organisms → Eukaryota511Open in IMG/M
3300007955|Ga0105740_1105990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia501Open in IMG/M
3300008929|Ga0103732_1035254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300008932|Ga0103735_1073780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300008958|Ga0104259_1008557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata918Open in IMG/M
3300008993|Ga0104258_1045122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea825Open in IMG/M
3300008996|Ga0102831_1285935Not Available544Open in IMG/M
3300009003|Ga0102813_1270006All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Myxozoa → Myxosporea → Bivalvulida → Platysporina → Myxobolidae → Myxobolus → Myxobolus squamalis526Open in IMG/M
3300009003|Ga0102813_1295854Not Available501Open in IMG/M
3300009068|Ga0114973_10613154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa557Open in IMG/M
3300009071|Ga0115566_10790739Not Available522Open in IMG/M
3300009080|Ga0102815_10852503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300009080|Ga0102815_10874884Not Available514Open in IMG/M
3300009151|Ga0114962_10292393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea913Open in IMG/M
3300009155|Ga0114968_10768606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa502Open in IMG/M
3300009172|Ga0114995_10253877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea971Open in IMG/M
3300009272|Ga0103877_1006677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300009411|Ga0115017_1286453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300009411|Ga0115017_1438587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300009432|Ga0115005_11679187Not Available522Open in IMG/M
3300009441|Ga0115007_10356665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea953Open in IMG/M
3300009441|Ga0115007_10393166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea906Open in IMG/M
3300009441|Ga0115007_10546643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300009441|Ga0115007_10674168All Organisms → cellular organisms → Eukaryota692Open in IMG/M
3300009445|Ga0115553_1368922Not Available548Open in IMG/M
3300009543|Ga0115099_10780231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea764Open in IMG/M
3300009599|Ga0115103_1180317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea876Open in IMG/M
3300009677|Ga0115104_11266316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300009679|Ga0115105_11273263All Organisms → cellular organisms → Eukaryota506Open in IMG/M
3300009785|Ga0115001_10492612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300010307|Ga0129319_1002466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea714Open in IMG/M
3300010396|Ga0134126_12663992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300010883|Ga0133547_12057740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1043Open in IMG/M
3300010981|Ga0138316_10792165All Organisms → cellular organisms → Eukaryota984Open in IMG/M
3300010981|Ga0138316_11352840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea762Open in IMG/M
3300010987|Ga0138324_10448794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300010987|Ga0138324_10548088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300010987|Ga0138324_10626088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
3300012212|Ga0150985_120237059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea718Open in IMG/M
3300012471|Ga0129334_1028993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata789Open in IMG/M
3300012711|Ga0157607_1179934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300012714|Ga0157601_1089406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300012724|Ga0157611_1084574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300012733|Ga0157606_1106985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300012767|Ga0138267_1236823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea824Open in IMG/M
3300012778|Ga0138269_1032874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea724Open in IMG/M
3300012952|Ga0163180_11418804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300013006|Ga0164294_10858191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300014493|Ga0182016_10336761All Organisms → cellular organisms → Eukaryota911Open in IMG/M
3300017238|Ga0186197_114338All Organisms → cellular organisms → Eukaryota733Open in IMG/M
3300017262|Ga0186220_114055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea779Open in IMG/M
3300017262|Ga0186220_114655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300017788|Ga0169931_11032276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300018413|Ga0181560_10187421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1017Open in IMG/M
3300018423|Ga0181593_11022526Not Available566Open in IMG/M
3300018666|Ga0193159_1038117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300018676|Ga0193137_1050589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300018684|Ga0192983_1025729All Organisms → cellular organisms → Eukaryota798Open in IMG/M
3300018710|Ga0192984_1046395All Organisms → cellular organisms → Eukaryota861Open in IMG/M
3300018730|Ga0192967_1049480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea704Open in IMG/M
3300018763|Ga0192827_1030111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea928Open in IMG/M
3300018819|Ga0193497_1045230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea821Open in IMG/M
3300018871|Ga0192978_1038166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea904Open in IMG/M
3300018871|Ga0192978_1053547All Organisms → cellular organisms → Eukaryota755Open in IMG/M
3300018871|Ga0192978_1102610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300018874|Ga0192977_1058945All Organisms → cellular organisms → Eukaryota780Open in IMG/M
3300018880|Ga0193337_1034603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300018881|Ga0192908_10029680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300018883|Ga0193276_1123791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300018899|Ga0193090_1109226All Organisms → cellular organisms → Eukaryota627Open in IMG/M
3300018928|Ga0193260_10062943Not Available803Open in IMG/M
3300018928|Ga0193260_10089178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea669Open in IMG/M
3300018928|Ga0193260_10148842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300018968|Ga0192894_10107173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300018968|Ga0192894_10213405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300018979|Ga0193540_10096545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata815Open in IMG/M
3300018980|Ga0192961_10101352All Organisms → cellular organisms → Eukaryota872Open in IMG/M
3300018980|Ga0192961_10140399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300018989|Ga0193030_10308941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300019021|Ga0192982_10187120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea735Open in IMG/M
3300019031|Ga0193516_10204097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300019032|Ga0192869_10224030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta807Open in IMG/M
3300019032|Ga0192869_10259858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300019033|Ga0193037_10310212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300019033|Ga0193037_10376157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300019037|Ga0192886_10247387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300019037|Ga0192886_10308697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300019040|Ga0192857_10169334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata681Open in IMG/M
3300019045|Ga0193336_10504274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300019048|Ga0192981_10176168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300019048|Ga0192981_10184681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata818Open in IMG/M
3300019048|Ga0192981_10239315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300019048|Ga0192981_10299033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300019051|Ga0192826_10257349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300019051|Ga0192826_10265746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300019112|Ga0193106_1022441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300019117|Ga0193054_1025186Not Available871Open in IMG/M
3300019117|Ga0193054_1036152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300019123|Ga0192980_1055927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300019270|Ga0181512_1035534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300019270|Ga0181512_1164794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea795Open in IMG/M
3300020146|Ga0196977_1052098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea973Open in IMG/M
3300020147|Ga0196976_1043216All Organisms → cellular organisms → Eukaryota985Open in IMG/M
3300020183|Ga0194115_10121251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1415Open in IMG/M
3300020183|Ga0194115_10174508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300020205|Ga0211731_11325793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1326Open in IMG/M
3300020205|Ga0211731_11673951All Organisms → cellular organisms → Eukaryota960Open in IMG/M
3300021067|Ga0196978_1041652All Organisms → cellular organisms → Eukaryota856Open in IMG/M
3300021169|Ga0206687_1471833All Organisms → cellular organisms → Eukaryota847Open in IMG/M
3300021169|Ga0206687_1529057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300021305|Ga0210296_1026861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300021342|Ga0206691_1793331Not Available832Open in IMG/M
3300021350|Ga0206692_1599329All Organisms → cellular organisms → Eukaryota784Open in IMG/M
3300021350|Ga0206692_1703128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea882Open in IMG/M
3300021353|Ga0206693_1481186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea701Open in IMG/M
3300021359|Ga0206689_10579444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea944Open in IMG/M
3300021424|Ga0194117_10419457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300021792|Ga0226836_10381465Not Available807Open in IMG/M
3300021872|Ga0063132_105251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea798Open in IMG/M
3300021890|Ga0063090_1053138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300021910|Ga0063100_1022523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300021910|Ga0063100_1040809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300021912|Ga0063133_1035269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300021924|Ga0063085_1056310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea826Open in IMG/M
3300021960|Ga0222715_10633628Not Available547Open in IMG/M
3300021960|Ga0222715_10718782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300022529|Ga0242668_1044418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
(restricted) 3300023208|Ga0233424_10233212Not Available730Open in IMG/M
3300024343|Ga0244777_10944810Not Available501Open in IMG/M
3300024346|Ga0244775_11372887Not Available544Open in IMG/M
3300025381|Ga0208871_1053300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300025890|Ga0209631_10483013Not Available555Open in IMG/M
3300025933|Ga0207706_11169564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae640Open in IMG/M
3300027249|Ga0208175_1034133Not Available532Open in IMG/M
3300027249|Ga0208175_1035271Not Available523Open in IMG/M
3300027720|Ga0209617_10307824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300027736|Ga0209190_1127384All Organisms → cellular organisms → Eukaryota1134Open in IMG/M
3300027777|Ga0209829_10380628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300027786|Ga0209812_10177342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea990Open in IMG/M
3300027786|Ga0209812_10379260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae612Open in IMG/M
3300027793|Ga0209972_10382477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300027805|Ga0209229_10378528Not Available616Open in IMG/M
3300027805|Ga0209229_10419218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300027810|Ga0209302_10483268Not Available551Open in IMG/M
3300028575|Ga0304731_10451067All Organisms → cellular organisms → Eukaryota984Open in IMG/M
3300028575|Ga0304731_10469651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300028575|Ga0304731_10644066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300028575|Ga0304731_10979399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea762Open in IMG/M
3300028776|Ga0302303_10120677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea945Open in IMG/M
3300029908|Ga0311341_10660231All Organisms → cellular organisms → Eukaryota → Sar585Open in IMG/M
3300029908|Ga0311341_10701198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea564Open in IMG/M
3300029910|Ga0311369_10729633All Organisms → cellular organisms → Eukaryota810Open in IMG/M
3300030399|Ga0311353_11077710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea669Open in IMG/M
3300030528|Ga0210277_10504913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M
3300030528|Ga0210277_10933443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae614Open in IMG/M
3300030528|Ga0210277_10947728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea735Open in IMG/M
3300030531|Ga0210274_1129992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea795Open in IMG/M
3300030532|Ga0210290_1603667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300030537|Ga0247642_1020725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300030540|Ga0247649_1071553Not Available557Open in IMG/M
3300030545|Ga0210271_10399608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea816Open in IMG/M
3300030546|Ga0247646_1086338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea745Open in IMG/M
3300030548|Ga0210252_10279908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300030549|Ga0210257_10296753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300030549|Ga0210257_10355857All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300030549|Ga0210257_10920603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea717Open in IMG/M
3300030551|Ga0247638_1059349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea765Open in IMG/M
3300030551|Ga0247638_1110338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea629Open in IMG/M
3300030553|Ga0247645_1037986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea840Open in IMG/M
3300030553|Ga0247645_1047475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea796Open in IMG/M
3300030553|Ga0247645_1068043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea728Open in IMG/M
3300030564|Ga0210256_10211081All Organisms → cellular organisms → Eukaryota712Open in IMG/M
3300030564|Ga0210256_10557735All Organisms → cellular organisms → Eukaryota762Open in IMG/M
3300030564|Ga0210256_10664562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea756Open in IMG/M
3300030564|Ga0210256_11035808All Organisms → cellular organisms → Eukaryota794Open in IMG/M
3300030565|Ga0247635_1075273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300030572|Ga0210258_10075114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300030572|Ga0210258_10343445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae725Open in IMG/M
3300030572|Ga0210258_10753906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300030573|Ga0210272_1287201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300030573|Ga0210272_1293375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300030578|Ga0210275_10116168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300030578|Ga0210275_10139625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea714Open in IMG/M
3300030578|Ga0210275_10210420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300030578|Ga0210275_10405691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300030579|Ga0247633_10047341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea819Open in IMG/M
3300030585|Ga0247639_1102677All Organisms → cellular organisms → Eukaryota741Open in IMG/M
3300030592|Ga0247612_1050917All Organisms → cellular organisms → Eukaryota827Open in IMG/M
3300030593|Ga0210263_1115349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300030594|Ga0210280_1117746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300030595|Ga0210276_10597854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300030599|Ga0247630_1072897All Organisms → cellular organisms → Eukaryota723Open in IMG/M
3300030599|Ga0247630_1122029All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300030599|Ga0247630_1216544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae517Open in IMG/M
3300030601|Ga0247650_1066525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300030608|Ga0247651_10258812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300030609|Ga0247634_10264464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300030609|Ga0247634_10391557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300030621|Ga0247655_10094561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300030625|Ga0210259_11194191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300030625|Ga0210259_11952128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300030626|Ga0210291_10641387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300030626|Ga0210291_11363684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea705Open in IMG/M
3300030626|Ga0210291_11766808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300030626|Ga0210291_11914369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea700Open in IMG/M
3300030628|Ga0247629_10379359Not Available535Open in IMG/M
3300030630|Ga0210282_10096205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300030634|Ga0247636_10224188All Organisms → cellular organisms → Eukaryota608Open in IMG/M
3300030634|Ga0247636_10298491Not Available546Open in IMG/M
3300030671|Ga0307403_10350028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea791Open in IMG/M
3300030722|Ga0308137_1090019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300030738|Ga0265462_11556603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300030740|Ga0265460_11697514All Organisms → cellular organisms → Eukaryota642Open in IMG/M
3300030741|Ga0265459_11077449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300030741|Ga0265459_11515662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota767Open in IMG/M
3300030741|Ga0265459_11674999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300030741|Ga0265459_12871955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300030741|Ga0265459_13003596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300030743|Ga0265461_11246364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae773Open in IMG/M
3300030743|Ga0265461_13857561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300030758|Ga0138305_1196086All Organisms → cellular organisms → Eukaryota629Open in IMG/M
3300030774|Ga0074007_10729302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300030775|Ga0074021_1000002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300030775|Ga0074021_1410811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea936Open in IMG/M
3300030800|Ga0074032_10799181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300030840|Ga0074020_10034650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300030840|Ga0074020_10079854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae621Open in IMG/M
3300030840|Ga0074020_11036339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300030907|Ga0074013_10734783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300030907|Ga0074013_11968181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea700Open in IMG/M
3300030911|Ga0102763_10615624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea746Open in IMG/M
3300030911|Ga0102763_11017229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea775Open in IMG/M
3300030923|Ga0138296_1572537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300030923|Ga0138296_1632568All Organisms → cellular organisms → Eukaryota751Open in IMG/M
3300030938|Ga0138299_10788001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300030962|Ga0138297_1158595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300030979|Ga0068589_11396961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300031029|Ga0074012_10582624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300031032|Ga0073980_11241386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300031034|Ga0074041_10052778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300031057|Ga0170834_101406699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300031057|Ga0170834_105507334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea725Open in IMG/M
3300031062|Ga0073989_13540847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300031122|Ga0170822_11060007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300031211|Ga0307974_1098070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1109Open in IMG/M
3300031212|Ga0307959_1144251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300031231|Ga0170824_102737226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300031231|Ga0170824_114730250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea803Open in IMG/M
3300031231|Ga0170824_120055704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae543Open in IMG/M
3300031411|Ga0102761_12305648All Organisms → cellular organisms → Eukaryota829Open in IMG/M
3300031446|Ga0170820_10637797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea770Open in IMG/M
3300031446|Ga0170820_11970332Not Available771Open in IMG/M
3300031446|Ga0170820_12253612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea822Open in IMG/M
3300031446|Ga0170820_15267182Not Available515Open in IMG/M
3300031446|Ga0170820_15307133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea725Open in IMG/M
3300031446|Ga0170820_15323095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300031446|Ga0170820_17121155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea529Open in IMG/M
3300031469|Ga0170819_13315985Not Available585Open in IMG/M
3300031469|Ga0170819_14109980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea696Open in IMG/M
3300031469|Ga0170819_14151996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300031469|Ga0170819_15259820Not Available756Open in IMG/M
3300031474|Ga0170818_115459529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia631Open in IMG/M
3300031524|Ga0302320_11435104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea684Open in IMG/M
3300031569|Ga0307489_10268026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300031569|Ga0307489_10912865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300031570|Ga0308144_1042380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300031580|Ga0308132_1081945All Organisms → cellular organisms → Eukaryota664Open in IMG/M
3300031734|Ga0307397_10297805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300031788|Ga0302319_11009201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300031788|Ga0302319_11904861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300032092|Ga0315905_10667171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata928Open in IMG/M
3300032092|Ga0315905_10873039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300032739|Ga0315741_10843718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea804Open in IMG/M
3300032739|Ga0315741_10974182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300032739|Ga0315741_11064413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila722Open in IMG/M
3300032739|Ga0315741_11836144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300032756|Ga0315742_11281226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae761Open in IMG/M
3300032756|Ga0315742_11340535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300032756|Ga0315742_11473946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea724Open in IMG/M
3300032756|Ga0315742_13552256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae503Open in IMG/M
3300034021|Ga0335004_0308394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300034022|Ga0335005_0261858Not Available1044Open in IMG/M
3300034071|Ga0335028_0680551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300034167|Ga0335017_0652651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.53%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.38%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.26%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil8.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.53%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.21%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.92%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.60%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.60%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.28%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.96%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.96%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.96%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.32%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.32%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.32%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.32%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.32%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.32%
Delisea PulchraHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra0.32%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.32%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.32%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.64%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.64%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.64%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.64%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.64%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.64%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.64%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.64%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.64%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.64%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002039Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3Host-AssociatedOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300005418Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006107Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007319Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012778Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020147Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13CEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021067Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13CEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021792Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmerEnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030537Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030601Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030758Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030774Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030800Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030907Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030911Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031211Saline water microbial communities from Organic Lake, Antarctica - #784EnvironmentalOpen in IMG/M
3300031212Saline water microbial communities from Organic Lake, Antarctica - #494EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LBB32012_1007412213300002039Delisea PulchraLGEEDFRDAKSIIELLKENLTLWKEEEEGGQGDDA*
JGI24766J26685_1010831313300002161Freshwater And SedimentDDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL*
JGI24539J26755_1023040523300002186MarineDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL*
Ga0065166_1015660833300004112Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL*
Ga0063356_10228490913300004463Arabidopsis Thaliana RhizosphereMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL*
Ga0063356_10405197413300004463Arabidopsis Thaliana RhizosphereLDKIDDLGEDDFRDAKSIIELLKENITLWKEEEEGEGQNIEDL*
Ga0007748_1000301023300004769Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL*
Ga0007748_1166803433300004769Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL*
Ga0007756_1153986133300004795Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIE
Ga0007809_1011149123300004807FreshwaterMRLGEQALADALEKIDDVDEETFRDAKSIIELLKENLSLWKEEED*
Ga0068881_134199813300005418Freshwater LakeMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL*
Ga0068881_141605513300005418Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL*
Ga0078894_1073283623300005662Freshwater LakeLEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDDL*
Ga0078894_1158774823300005662Freshwater LakeLDKIDEISEEDFRDAKSIIELLKENLSLWKEEEGGQNIEDL*
Ga0007836_113441913300006107FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGADNQIDDL*
Ga0007836_113948723300006107FreshwaterEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL*
Ga0099654_1006623323300006415LakeVDEETFRDAKSIIELLKENLSLWKEEEADNAVEDL*
Ga0075467_1022041913300006803AqueousIDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL*MPPVN*
Ga0075467_1066213923300006803AqueousIDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL*TPLVN*
Ga0075464_1107006213300006805AqueousLEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL*
Ga0075179_163617243300007230Wastewater EffluentMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNQIEDL*
Ga0075179_163767413300007230Wastewater EffluentLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL*
Ga0102691_142759033300007319Freshwater LakeMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIE
Ga0105050_1038347213300007516FreshwaterMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL*
Ga0102822_104795113300007558EstuarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL*
Ga0102908_112295523300007665EstuarineSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL*
Ga0102951_108066123300007725WaterLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEENQVDDL*
Ga0102951_124448923300007725WaterLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVDDL*
Ga0105740_110599013300007955Estuary WaterEALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIDDL*
Ga0103732_103525423300008929Ice Edge, Mcmurdo Sound, AntarcticaLGEKALADALDKIDDVDEETFRDAKSIIELLKENLSLWKEE*
Ga0103735_107378013300008932Ice Edge, Mcmurdo Sound, AntarcticaLGEKALADALDKIDDVDEETFRDAKSIIELLKENLSLW
Ga0104259_100855743300008958Ocean WaterLEEDDFRDAKSIIELLKENLTLWKEEDDENAIDDL*
Ga0104258_104512213300008993Ocean WaterLSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL*
Ga0102831_128593513300008996EstuarineALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL*
Ga0102813_127000613300009003EstuarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEE*
Ga0102813_129585413300009003EstuarineTALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDQNAVEDL*
Ga0114973_1061315413300009068Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEDGGADNNIEDL*
Ga0115566_1079073913300009071Pelagic MarineLTDALEKIDDVDEEVFRDAKSIIELLKENLSLWKEDDVDNVEDL*
Ga0102815_1085250313300009080EstuarineVEDEFRDAKSIIELLKENLTLWKDEEQDGNEIDDL*
Ga0102815_1087488413300009080EstuarineSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL*
Ga0114962_1029239333300009151Freshwater LakeLEKIDDVDEETFRDAKSIIELLKENLSLWKEEED*
Ga0114968_1076860613300009155Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNDNNIEDL*
Ga0114995_1025387713300009172MarineLEKIDDVDEDTFRDAKSIIELLKENLSLWKEEEGDNIEDL*
Ga0103877_100667713300009272Surface Ocean WaterLEEDDFRDAKSIIELLKENLTLWKEEEEGGDDAVEDMQ*
Ga0115017_128645323300009411SoilLQNALEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGAGNDVEDM*
Ga0115017_143858713300009411SoilLDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL*
Ga0115005_1167918723300009432MarineDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL*
Ga0115007_1035666513300009441MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGGNDVEDL*
Ga0115007_1039316623300009441MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDGNNNVEDL*
Ga0115007_1054664333300009441MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGEGVEDL*
Ga0115007_1067416823300009441MarineMNKIDEVNEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL*
Ga0115553_136892223300009445Pelagic MarineGEAALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL*
Ga0115099_1078023113300009543MarineLTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL*
Ga0115103_118031733300009599MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDEGDNAVEDL*
Ga0115104_1126631623300009677MarineLSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL*
Ga0115105_1127326313300009679MarineMGEKSLSDALDKIDDVDEETFRDAKSIIELLKENLSLWKEEEGNDVEDL*
Ga0115001_1049261233300009785MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEGAGQD*
Ga0129319_100246623300010307AqueousLDKIDEIEEDDFRDAKSIIGLLKENLTLWKEEEDGDNNIDDL*
Ga0134126_1266399213300010396Terrestrial SoilDKIDELNEDDFRDAKSIIELLKENLTLWKEEEEGGQNIEDL*
Ga0133547_1205774023300010883MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL*
Ga0138316_1079216533300010981MarineVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL*
Ga0138316_1135284023300010981MarineLAEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL*
Ga0138324_1044879423300010987MarineLSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVE
Ga0138324_1054808833300010987MarineLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEGDNNIDDL*
Ga0138324_1062608823300010987MarineLQDVIDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL*
Ga0150985_12023705913300012212Avena Fatua RhizosphereLDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL*
Ga0129334_102899323300012471AqueousLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIEDF*
Ga0157607_117993423300012711FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDDL*
Ga0157601_108940623300012714FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDG
Ga0157611_108457423300012724FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGD
Ga0157606_110698523300012733FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDD
Ga0138267_123682313300012767Polar MarineMGEQALTDALDKIDDADEDEFREAKSIIELLKENLSLWKESD*
Ga0138269_103287423300012778Freshwater LakeLEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDD
Ga0163180_1141880423300012952SeawaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGEGQEIDDL*
Ga0164294_1085819123300013006FreshwaterMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEDNDNNIEDL*
Ga0182016_1033676123300014493BogMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDQNIEDL*
Ga0186197_11433833300017238Host-AssociatedLGEIALNNALEKIDECDEETFRDAKNIIELLKENLSLWKEEGEDEKE
Ga0186220_11405523300017262Host-AssociatedLEKIDDCDEETFRDAKSIIELLKENLSLWKEDEEDNKGEDN
Ga0186220_11465513300017262Host-AssociatedMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEENQNADDQ
Ga0169931_1103227613300017788FreshwaterQEALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNYLNDM
Ga0181560_1018742123300018413Salt MarshLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVDDL
Ga0181593_1102252613300018423Salt MarshLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0193159_103811723300018666MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEENEGVEDL
Ga0193137_105058923300018676MarineLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGDGQEIDDL
Ga0192983_102572913300018684MarineLADASLTDALDKIDELEEDAFRDAKSIIELLKENLTLWKEEEGDNIDDL
Ga0192984_104639533300018710MarineLEEDDFRDAKSIIELLKENLTLWKEEDDENAIDDL
Ga0192967_104948013300018730MarineMALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0192827_103011113300018763MarineLGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL
Ga0193497_104523023300018819MarineLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGEGQEIDDL
Ga0192978_103816613300018871MarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL
Ga0192978_105354733300018871MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGNNDVEDL
Ga0192978_110261023300018871MarineLEEDDFRDAKSIIELLKENLTLWKEEDDDNAIDDL
Ga0192977_105894533300018874MarineLGEQALGDALEKIDDVDEETFREAKSIIELLKENLSIWKESEEQNIEDL
Ga0193337_103460313300018880MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEENDNAVEDL
Ga0192908_1002968033300018881MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL
Ga0193276_112379113300018883MarineLQSALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDDDNAIDDL
Ga0193090_110922633300018899MarineLADASLTDALDKIDELEEDAFRDAKSIIELLKENLTLWKEEEGD
Ga0193260_1006294313300018928MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGANDVEDLXERXL
Ga0193260_1008917833300018928MarineLADESLQQALDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDN
Ga0193260_1014884213300018928MarineMGKIDDVDEEMFRDAKSIIELLKENLTLWKEEDGGDNNIEDM
Ga0192894_1010717313300018968MarineLELGEKALSDALEKIDDVDEETFRDAKSIIELLKENISLWKEEDDPEDL
Ga0192894_1021340523300018968MarineLTEALEKIDDVDEETFRDAKSIIELLKENISLWKEEEGGVEDLXINLNFI
Ga0193540_1009654533300018979MarineLQEALDKIDELEEEDFRDAKSIIELLKENLTLWKEEEDNADVDQIDAI
Ga0192961_1010135213300018980MarineLEEDDFRDAKSIIELLKENLTLWKEEENGNEIDDI
Ga0192961_1014039933300018980MarineLSNALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDDQNAVQDL
Ga0193030_1030894113300018989MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDGNAVEDL
Ga0192982_1018712023300019021MarineMGEQALTDALDKIDDADEDEFREAKSIIELLKENLSLWKESD
Ga0193516_1020409723300019031MarineMTTKKLVSWGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDLXV
Ga0192869_1022403013300019032MarineLTKALENIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL
Ga0192869_1025985813300019032MarineLDKIDELGEDDFRDAKSIIELLKENLTLWGEEEEDGNQIDDLXI
Ga0193037_1031021223300019033MarineLTEALEHIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL
Ga0193037_1037615713300019033MarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDDNNAVEDL
Ga0192886_1024738713300019037MarineLTEALEKIDDVDEETFRDAKSIVELLKENLSLWKEEEGDNAVDDL
Ga0192886_1030869713300019037MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGGNDVEDL
Ga0192857_1016933413300019040MarineVKLADQALQDALDKIDELEEDDFRDAKSIIELLKENLTLLKEEQDDDNAIDDL
Ga0193336_1050427413300019045MarineLEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDGNNVEDL
Ga0192981_1017616823300019048MarineLEEDEFRDAKSIIELLKENLTLWKEDDEENNIDDL
Ga0192981_1018468133300019048MarineLEEDDFRDAKSIIELLKENLTLWKEEEEGDNNIDDL
Ga0192981_1023931523300019048MarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEE
Ga0192981_1029903323300019048MarineLGEQALGDALEKIDDVDEETFREAKSIIELLKENLSIWKESEEQNI
Ga0192826_1025734913300019051MarineLTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEGGDDQ
Ga0192826_1026574623300019051MarineLGEEALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDENAVEDL
Ga0193106_102244123300019112MarineLQEALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDNADVDQIDAI
Ga0193054_102518623300019117MarineMTLGETALQEALDKIDECDEETFRDAKSIIELLKENLSLWKEEDEGQEVDDL
Ga0193054_103615223300019117MarineLGEQALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEE
Ga0192980_105592723300019123MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSTWKEEDGDVEDL
Ga0181512_103553423300019270PeatlandMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0181512_116479413300019270PeatlandLGEEDFRDAKSIIELLKENITLWKEEEEGGDNNIEDL
Ga0196977_105209813300020146SoilMSKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0196976_104321613300020147SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVFFT
Ga0194115_1012125113300020183Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL
Ga0194115_1017450833300020183Freshwater LakeMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL
Ga0211731_1132579313300020205FreshwaterMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL
Ga0211731_1167395133300020205FreshwaterMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNDNNIEDL
Ga0196978_104165213300021067SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVFF
Ga0206687_147183313300021169SeawaterLTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0206687_152905723300021169SeawaterLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEE
Ga0210296_102686113300021305EstuarineLSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL
Ga0206691_179333133300021342SeawaterVDEETFRDAKSIIELLKENLSLWKEEEGGDNNVEDL
Ga0206692_159932933300021350SeawaterLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGENAVEDL
Ga0206692_170312833300021350SeawaterLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDEGDNAVEDL
Ga0206693_148118633300021353SeawaterLEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGANDVEDL
Ga0206689_1057944413300021359SeawaterLSDALEKIDDVDDETSRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0194117_1041945723300021424Freshwater LakeMLASSPKKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGDNQIDDL
Ga0226836_1038146513300021792Hydrothermal Vent FluidsLNKFRYQEDDDVDEETFRDAKSIIELLKENLSLWKEEEADNKVEDL
Ga0063132_10525133300021872MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNGVEDL
Ga0063090_105313833300021890MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL
Ga0063100_102252323300021910MarineMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0063100_104080923300021910MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDGNNNVEDL
Ga0063133_103526913300021912MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0063085_105631033300021924MarineLTEALEKIDDVDEETFRDAKSIIELLKENLXLWKEEDEGDNAVEDL
Ga0222715_1063362813300021960Estuarine WaterELGEAALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL
Ga0222715_1071878213300021960Estuarine WaterLSNALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDQNNVEDL
Ga0242668_104441813300022529SoilLGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL
(restricted) Ga0233424_1023321213300023208FreshwaterALSDALDKLDDCDEETFRDAQSIIELLRENLGLWKDEERDM
Ga0244777_1094481013300024343EstuarineDDVDEDTFRDAKSIIELLKENLTLWKEEDGDNNIEDL
Ga0244775_1137288723300024346EstuarineDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0208871_105330013300025381FreshwaterTALQDAMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL
Ga0209631_1048301313300025890Pelagic MarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDLXAXNLSP
Ga0207706_1116956413300025933Corn RhizosphereCDEETFRDAKSIIELLKENLSLWKEEEDENKEVEDL
Ga0208175_103413313300027249EstuarineSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0208175_103527123300027249EstuarineDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL
Ga0209617_1030782413300027720Freshwater And SedimentMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDN
Ga0209190_112738413300027736Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL
Ga0209829_1038062823300027777Freshwater LakeLEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDDL
Ga0209812_1017734233300027786Wastewater EffluentMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNQIEDL
Ga0209812_1037926013300027786Wastewater EffluentLEKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL
Ga0209972_1038247713300027793Freshwater LakeMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL
Ga0209229_1037852813300027805Freshwater And SedimentKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL
Ga0209229_1041921813300027805Freshwater And SedimentEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDLXRE
Ga0209302_1048326813300027810MarineELGEDDFRDAKSIIELLKENLTLWKEEAEEGNDNEVDDI
Ga0304731_1045106733300028575MarineVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL
Ga0304731_1046965123300028575MarineLGEQALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDADNA
Ga0304731_1064406623300028575MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDG
Ga0304731_1097939923300028575MarineLAEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL
Ga0302303_1012067713300028776PalsaLGEEDFRDAKSIIELLKENLTLWKEEEEGGEQNIEDL
Ga0311341_1066023123300029908BogMNKIDDVDEETFRDAKSIIELLKENLTLWKEDEGADNHIEDL
Ga0311341_1070119823300029908BogMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDL
Ga0311369_1072963313300029910PalsaMSKIDDVDEEVFRDAKSIIELLKENLTLWKDEDAGGDNA
Ga0311353_1107771023300030399PalsaLGEEDFRDAKSIIELLKENLTLWKEEEEGGEQNIED
Ga0210277_1050491323300030528SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEEKNDIEDL
Ga0210277_1093344313300030528SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEDEDNKGDIEDL
Ga0210277_1094772813300030528SoilLGEEDFRDAKSIIELLKENITLWKEEEDGADNNIEDL
Ga0210274_112999213300030531SoilLGEEEFRDAKSIIELLKENLTLWKEEEEGAGNEIQDL
Ga0210290_160366713300030532SoilLDKIDDLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL
Ga0247642_102072513300030537SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGGDNNIDDL
Ga0247649_107155323300030540SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDL
Ga0210271_1039960823300030545SoilLGEEDFRDAKSIIELLKENITLWKEEEDGADNAIEDL
Ga0247646_108633823300030546SoilLDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGGDNAIEDL
Ga0210252_1027990823300030548SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEDAGEGGLEDL
Ga0210257_1029675313300030549SoilMNLCRPLDKIDDLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL
Ga0210257_1035585713300030549SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGDAKNEIDDLXSICIP
Ga0210257_1092060323300030549SoilLAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEEEGGKNIDDL
Ga0247638_105934913300030551SoilMNRIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0247638_111033833300030551SoilLDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGAD
Ga0247645_103798623300030553SoilLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL
Ga0247645_104747513300030553SoilMNKIEEIGEDMFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0247645_106804323300030553SoilLNEDDFRDAKSIIELLKENITLWKEEDEGGDNNVEDL
Ga0210256_1021108133300030564SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGE
Ga0210256_1055773513300030564SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXSS
Ga0210256_1066456213300030564SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNVEDM
Ga0210256_1103580813300030564SoilLAEVALQDAMNKIDDVDEEAFRDAKSIIELLKENLTLWKEEENGDNNIEDM
Ga0247635_107527323300030565SoilLEKIDELDEETFRDAKSIIELLKENLTLWKDEEEGG
Ga0210258_1007511413300030572SoilLAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEDEGGKN
Ga0210258_1034344513300030572SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEDEDAGKNEIDDL
Ga0210258_1075390623300030572SoilLDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL
Ga0210272_128720113300030573SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGEGGENN
Ga0210272_129337513300030573SoilLGEEDFRDAKSIIELLKQNITLWKEEEDGADNNIEDL
Ga0210275_1011616813300030578SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGGDKDIEDL
Ga0210275_1013962513300030578SoilLQAALDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL
Ga0210275_1021042023300030578SoilLAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDDEQADNNIEDL
Ga0210275_1040569123300030578SoilLLADESLQAALDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEDGADNAIEEL
Ga0247633_1004734123300030579SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXVGSL
Ga0247639_110267733300030585SoilLGEEDFRDAKSIIELLKENLTLWKEEEEDGTADDA
Ga0247612_105091713300030592SoilLGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL
Ga0210263_111534913300030593SoilLDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGGEAIEDL
Ga0210280_111774613300030594SoilLDKLDDCDEEMFRDAQSIIELLRENLALWKEEDEGNNNNEI
Ga0210276_1059785423300030595SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEDKNDIEDL
Ga0247630_107289733300030599SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXVS
Ga0247630_112202933300030599SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGD
Ga0247630_121654423300030599SoilLNKIDDCDEETFRDAKSIIELLKENLSLWKEEDEGKNEI
Ga0247650_106652523300030601SoilLDKIDELGEEDFRDAKSIIELLKENLTLWKDEEEGGGDNIEDL
Ga0247651_1025881213300030608SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGADNNIEDL
Ga0247634_1026446413300030609SoilLNEDDFRDAKSIIELLKENITLWKEEDESGDNNVEDL
Ga0247634_1039155723300030609SoilLGEEDFRDAKSIIELLMENLTLWKEEEEGGQGDDA
Ga0247655_1009456123300030621SoilMNKIDEIGEDMFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVSICQKYP
Ga0210259_1119419133300030625SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGENNIEDMXFSLFA
Ga0210259_1195212833300030625SoilMSKIDDVDEDTFRDAKSIIELLKENLTLWQDDGDGAEGAIEDL
Ga0210291_1064138713300030626SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEEADGKNDIADL
Ga0210291_1136368413300030626SoilLDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL
Ga0210291_1176680823300030626SoilLDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDF
Ga0210291_1191436913300030626SoilLDKIDDIGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNI
Ga0247629_1037935913300030628SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXTLFSP
Ga0210282_1009620523300030630SoilMNKIDEVDEETFRDAKSIIELLKENLTLWKEEPEKGGNEVDDM
Ga0247636_1022418813300030634SoilLADEALQAALDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEGG
Ga0247636_1029849113300030634SoilIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNKRNGRR
Ga0307403_1035002823300030671MarineLGEQALGDALEKIDDVDEETFRDAKSIIELLKENLSIWKESEEQNIEDL
Ga0308137_109001913300030722MarineLTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGENGVEDL
Ga0265462_1155660323300030738SoilLDKIDDLGEEDFRDAKSIIELLKENITLWKEDDENGGTNNIEDL
Ga0265460_1169751433300030740SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEECGDQNIEDL
Ga0265459_1107744933300030741SoilLAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEEEGGKNIDD
Ga0265459_1151566233300030741SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGDAKNEIDDL
Ga0265459_1167499913300030741SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGKNDVDDM
Ga0265459_1287195523300030741SoilLDEETFKDAKSIIELLKENLTLWKEEEEGGHNEDEN
Ga0265459_1300359613300030741SoilVLADETLQKALEKIDELTEEDFRDAKSIIELLKENHSLWKEEENAGDNPVEEL
Ga0265461_1124636423300030743SoilMDDCDEDTFRDAKSISELLKENLSLWKEEEDEGKNVEDL
Ga0265461_1385756113300030743SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXRA
Ga0138305_119608613300030758SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAY
Ga0074007_1072930213300030774SoilLADEALQAALDKIDDIAEEDFRDAKSIIELLKENLSLWKEEEEGGDNNIDDLNL
Ga0074021_100000223300030775SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXAGP
Ga0074021_141081113300030775SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEDGGDNNIEDLXSLFVLC
Ga0074032_1079918113300030800SoilMSKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGKNDVDDMXXEGDCE
Ga0074020_1003465013300030840SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNEI
Ga0074020_1007985433300030840SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDENKNDIEDL
Ga0074020_1103633913300030840SoilLDKIDDIGEEDFRDAKSIIELLKENLTLWKEEEEGGQNIEDL
Ga0074013_1073478323300030907SoilLDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL
Ga0074013_1196818113300030907SoilLQDALDKLDDCDEETFRDAQSIIELLRENLALWKEEDEG
Ga0102763_1061562413300030911SoilLDKIDDLGEEDFRDAKSIIELLKENITLWKEEEEGGDNNIEDL
Ga0102763_1101722913300030911SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGGKNDIEDL
Ga0138296_157253713300030923SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNDIQDL
Ga0138296_163256813300030923SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDQNIEDL
Ga0138296_165516933300030923SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAYVRRNSYFLIL
Ga0138299_1078800123300030938SoilLQNALEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGAGNDVEDM
Ga0138297_115859523300030962SoilLDKIDDLNEEDFRDAKSIIELLKENLTLWKEEEEGADGNNIDDL
Ga0068589_1139696113300030979SoilLGDKALQDALDKLDDCNEETFRDAQSIIELLRENLALWKEEDEGNQNAIEDL
Ga0074012_1058262413300031029SoilLEKIDELDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL
Ga0073980_1124138613300031032MarineLEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL
Ga0074041_1005277823300031034SoilLGEEEFRDAKSIIELLKENLTLWKEEEEGGANEIQDL
Ga0170834_10140669913300031057Forest SoilLQGALDKIDELDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL
Ga0170834_10550733423300031057Forest SoilMNKIDEVDEETFRDAKSIIELLKENLTLWKEEAEGGKEVDDL
Ga0073989_1354084733300031062MarineLGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL
Ga0170822_1106000723300031122Forest SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEE
Ga0307974_109807013300031211Saline WaterLADALAKLDDVDEETFRESQSIIELLKENLTLWKEEGGDNNVDDL
Ga0307959_114425123300031212Saline WaterLADALAKLDDVDEETFRESQSIIELLKENLTLWKEEGGDNNVD
Ga0170824_10273722623300031231Forest SoilLADESLQQALDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEVGDNAIEDL
Ga0170824_11473025023300031231Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDDEGGDNNAIEDL
Ga0170824_12005570423300031231Forest SoilLDKLDDCDEEMFRDAQSIIELLRENLALWKEEDEGNNNAIEDL
Ga0102761_1230564813300031411SoilLDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL
Ga0170820_1063779723300031446Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEAGDGD
Ga0170820_1197033233300031446Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEDNND
Ga0170820_1225361223300031446Forest SoilLGEEDFRDAKSIIELLKENITLWKEEEDGADNQIEDL
Ga0170820_1526718213300031446Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEVEGGD
Ga0170820_1530713313300031446Forest SoilLAEESLQAALDKIDDLGEDDFRDAKSIIELLKENITLWKEDEAEGEQPIEEL
Ga0170820_1532309523300031446Forest SoilLGEDDFRDAKSIIELLKENITLWKEEEEGETNNNIEDL
Ga0170820_1712115513300031446Forest SoilMNKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGGDGKDVDDL
Ga0170819_1331598513300031469Forest SoilMSKIDEVDEETFRDAKSIIELLKENKTLWKEEDGEGKNEIDDL
Ga0170819_1410998033300031469Forest SoilLDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL
Ga0170819_1415199613300031469Forest SoilMNKIDDVEEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL
Ga0170819_1525982013300031469Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAYVVISYC
Ga0170818_11545952933300031474Forest SoilLERIDDCDEETFRDAKSIIELLKENLSLWKEDEGEKEVEDM
Ga0302320_1143510423300031524BogMNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL
Ga0307489_1026802613300031569Sackhole BrineVDEETFRDAKSIIELLKENLSLWKEEEDQNAVEDL
Ga0307489_1091286513300031569Sackhole BrineLSEALINIDDVDEVTFKDSKSIIELLKENLSLWKEEKLNDEEN
Ga0308144_104238013300031570MarineLEKIDDVDEDTFRDAKSIIELLKENLSLWKEEEGDNIEDL
Ga0308132_108194513300031580MarineMGEKALSDALDKIDDVDEETFRDAKSIIELLKENISLWKEEEGNDDNDVEDL
Ga0307397_1029780523300031734MarineLSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNEVQDL
Ga0302319_1100920123300031788BogMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNVDDL
Ga0302319_1190486113300031788BogLDKLDDCDEETFRDAQSIIELLRENLALWKEEDEGN
Ga0315905_1066717123300032092FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIEDF
Ga0315905_1087303913300032092FreshwaterLDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDDL
Ga0315741_1084371823300032739Forest SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEDDDDKNDIEDL
Ga0315741_1097418243300032739Forest SoilLDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL
Ga0315741_1106441333300032739Forest SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDEGKNDIEDL
Ga0315741_1183614413300032739Forest SoilMNKIDDVDEETFRDAKSIIELLKENLTLWKEDEGGDNNIEDL
Ga0315742_1128122613300032756Forest SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDDNKNEIEDL
Ga0315742_1134053513300032756Forest SoilMSKIEEVDEETFRDAKSIIELLKENLTLWKEEEADGKNDIEDL
Ga0315742_1147394613300032756Forest SoilLAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEDEGGKNIDDL
Ga0315742_1355225613300032756Forest SoilLEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDENKNEIEDL
Ga0335004_0308394_131_2383300034021FreshwaterVDEETFRDAKSIIELLKENLSLWKEEEADNAVEDL
Ga0335005_0261858_805_9153300034022FreshwaterVDEETFRDAKSIIELLKENLSLWKEEEDKNNADEDL
Ga0335028_0680551_397_5403300034071FreshwaterALQDALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL
Ga0335017_0652651_2_1333300034167FreshwaterALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.