NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039667

Metagenome / Metatranscriptome Family F039667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039667
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 60 residues
Representative Sequence MAFYGVNMDVMVRELNLKFKLAIQQKGGVGIRSLRNIFRRMDFNGNKKLDSGEFEQALAAFG
Number of Associated Samples 132
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.36 %
% of genes near scaffold ends (potentially truncated) 46.01 %
% of genes from short scaffolds (< 2000 bps) 98.77 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.706 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.153 % of family members)
Environment Ontology (ENVO) Unclassified
(38.650 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(50.920 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.78%    β-sheet: 0.00%    Coil/Unstructured: 52.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF13499EF-hand_7 41.72
PF00036EF-hand_1 11.04
PF13202EF-hand_5 10.43
PF13405EF-hand_6 4.29
PF13833EF-hand_8 2.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.39 %
UnclassifiedrootN/A0.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001271|BBAY90_10016370All Organisms → cellular organisms → Eukaryota1156Open in IMG/M
3300002024|MIS_1110717All Organisms → cellular organisms → Eukaryota1118Open in IMG/M
3300004794|Ga0007751_10552897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300005516|Ga0066831_10073465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300005516|Ga0066831_10230482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300005527|Ga0068876_10232402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1062Open in IMG/M
3300005590|Ga0070727_10222599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1055Open in IMG/M
3300005662|Ga0078894_10463962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1140Open in IMG/M
3300005662|Ga0078894_10539804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1044Open in IMG/M
3300005662|Ga0078894_10648790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata936Open in IMG/M
3300005758|Ga0078117_1137330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1188Open in IMG/M
3300005758|Ga0078117_1138698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1179Open in IMG/M
3300006357|Ga0075502_1497481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila757Open in IMG/M
3300006383|Ga0075504_1300820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1045Open in IMG/M
3300006571|Ga0075505_1422158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1039Open in IMG/M
3300006641|Ga0075471_10117882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1418Open in IMG/M
3300006803|Ga0075467_10032004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3344Open in IMG/M
3300006803|Ga0075467_10140278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1397Open in IMG/M
3300006803|Ga0075467_10362892All Organisms → cellular organisms → Eukaryota759Open in IMG/M
3300006805|Ga0075464_10253183All Organisms → cellular organisms → Eukaryota1053Open in IMG/M
3300006805|Ga0075464_10418451All Organisms → cellular organisms → Eukaryota816Open in IMG/M
3300006805|Ga0075464_10897096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea553Open in IMG/M
3300007559|Ga0102828_1093242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300007559|Ga0102828_1196667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300007561|Ga0102914_1073067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1076Open in IMG/M
3300007644|Ga0102902_1039765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1411Open in IMG/M
3300007649|Ga0102912_1082967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300007651|Ga0102900_1019511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1407Open in IMG/M
3300007718|Ga0102852_1104538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300008114|Ga0114347_1109706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1051Open in IMG/M
3300008117|Ga0114351_1266569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea837Open in IMG/M
3300008958|Ga0104259_1003823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1209Open in IMG/M
3300008999|Ga0102816_1049142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1253Open in IMG/M
3300009000|Ga0102960_1274739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300009159|Ga0114978_10229931All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300009163|Ga0114970_10559971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300009216|Ga0103842_1002029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1135Open in IMG/M
3300009432|Ga0115005_10649734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata846Open in IMG/M
3300009436|Ga0115008_10433118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300009436|Ga0115008_10489521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata878Open in IMG/M
3300009436|Ga0115008_10531317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata842Open in IMG/M
3300009436|Ga0115008_10598112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea794Open in IMG/M
3300009436|Ga0115008_10653580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata760Open in IMG/M
3300009441|Ga0115007_10187268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1334Open in IMG/M
3300009441|Ga0115007_11291251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300009537|Ga0129283_10210496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea816Open in IMG/M
3300009543|Ga0115099_11006318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300009599|Ga0115103_1852110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300009606|Ga0115102_10944874All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300010334|Ga0136644_10278354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea975Open in IMG/M
3300010885|Ga0133913_12652581All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300010885|Ga0133913_13187324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1085Open in IMG/M
3300012417|Ga0138262_1642030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea987Open in IMG/M
3300012953|Ga0163179_10614526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata913Open in IMG/M
3300012953|Ga0163179_11842133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300012954|Ga0163111_11694963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300013004|Ga0164293_10346868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1014Open in IMG/M
3300013004|Ga0164293_10812002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300013005|Ga0164292_10551770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300013233|Ga0172420_10450378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea963Open in IMG/M
3300013295|Ga0170791_15103791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300017107|Ga0186524_109221All Organisms → cellular organisms → Eukaryota1127Open in IMG/M
3300017210|Ga0186339_107111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1352Open in IMG/M
3300017262|Ga0186220_110840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1020Open in IMG/M
3300017788|Ga0169931_10335077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1161Open in IMG/M
3300017788|Ga0169931_11028556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300018410|Ga0181561_10190056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1015Open in IMG/M
3300018613|Ga0188872_1009480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300018684|Ga0192983_1005652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1352Open in IMG/M
3300018710|Ga0192984_1068644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300018739|Ga0192974_1011253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1424Open in IMG/M
3300018926|Ga0192989_10040301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1187Open in IMG/M
3300018961|Ga0193531_10108748All Organisms → cellular organisms → Eukaryota1090Open in IMG/M
3300018968|Ga0192894_10080970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata949Open in IMG/M
3300019017|Ga0193569_10136926All Organisms → cellular organisms → Eukaryota1110Open in IMG/M
3300019021|Ga0192982_10032090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1424Open in IMG/M
3300019021|Ga0192982_10073732All Organisms → cellular organisms → Eukaryota1084Open in IMG/M
3300019108|Ga0192972_1014552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1427Open in IMG/M
3300019153|Ga0192975_10066963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1270Open in IMG/M
3300019201|Ga0180032_1027941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300020159|Ga0211734_10432687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300020160|Ga0211733_11249035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1092Open in IMG/M
3300020183|Ga0194115_10174061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1092Open in IMG/M
3300020183|Ga0194115_10181349All Organisms → cellular organisms → Eukaryota1060Open in IMG/M
3300020205|Ga0211731_10970551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1722Open in IMG/M
3300020214|Ga0194132_10543380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300021091|Ga0194133_10233689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1185Open in IMG/M
3300021108|Ga0214162_1020488All Organisms → Viruses → Predicted Viral1174Open in IMG/M
3300021336|Ga0210307_1284480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1068Open in IMG/M
3300021350|Ga0206692_1043348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea987Open in IMG/M
3300021350|Ga0206692_1903359All Organisms → cellular organisms → Eukaryota711Open in IMG/M
3300021353|Ga0206693_1124191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300021869|Ga0063107_103622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea991Open in IMG/M
3300021887|Ga0063105_1000832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1106Open in IMG/M
3300021889|Ga0063089_1003605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1088Open in IMG/M
3300021896|Ga0063136_1060916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1139Open in IMG/M
3300021898|Ga0063097_1043201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300021928|Ga0063134_1046611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1133Open in IMG/M
3300021941|Ga0063102_1041471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1139Open in IMG/M
3300021954|Ga0063755_1038397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea967Open in IMG/M
3300022745|Ga0228698_1141103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
(restricted) 3300023210|Ga0233412_10439536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300023439|Ga0256752_1042406All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300023442|Ga0256751_1099978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1093Open in IMG/M
(restricted) 3300024259|Ga0233437_1390590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae509Open in IMG/M
3300024343|Ga0244777_10521119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea728Open in IMG/M
3300024343|Ga0244777_10805338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300024346|Ga0244775_11161510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300025848|Ga0208005_1040449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1442Open in IMG/M
3300025887|Ga0208544_10005092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida7939Open in IMG/M
3300025887|Ga0208544_10090424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1397Open in IMG/M
3300025896|Ga0208916_10224479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea815Open in IMG/M
3300026182|Ga0208275_1026728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1207Open in IMG/M
3300027254|Ga0208177_1098895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300027586|Ga0208966_1051475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1175Open in IMG/M
3300027720|Ga0209617_10096576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1195Open in IMG/M
3300027760|Ga0209598_10125679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1169Open in IMG/M
3300027782|Ga0209500_10138192All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300027810|Ga0209302_10091086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1550Open in IMG/M
3300027810|Ga0209302_10116216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1334Open in IMG/M
3300027833|Ga0209092_10195501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1140Open in IMG/M
3300027833|Ga0209092_10315489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata842Open in IMG/M
3300027833|Ga0209092_10587507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300027849|Ga0209712_10391698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata783Open in IMG/M
3300028335|Ga0247566_1048341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300029908|Ga0311341_10403101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea791Open in IMG/M
3300029913|Ga0311362_11283313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300030610|Ga0247613_10243022All Organisms → cellular organisms → Eukaryota654Open in IMG/M
3300030626|Ga0210291_10231677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300030626|Ga0210291_10457106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea935Open in IMG/M
3300030670|Ga0307401_10087653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1321Open in IMG/M
3300030699|Ga0307398_10387111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea765Open in IMG/M
3300030709|Ga0307400_10312113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea998Open in IMG/M
3300030709|Ga0307400_10859003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300030740|Ga0265460_10692744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea862Open in IMG/M
3300030741|Ga0265459_10817907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300030786|Ga0073966_11674932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea598Open in IMG/M
3300030788|Ga0073964_11619689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1009Open in IMG/M
3300030948|Ga0073977_1001308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea990Open in IMG/M
3300031005|Ga0073974_1015890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1082Open in IMG/M
3300031006|Ga0073973_1731274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea996Open in IMG/M
3300031057|Ga0170834_103940435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300031335|Ga0307951_1051547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1555Open in IMG/M
3300031569|Ga0307489_10825206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata654Open in IMG/M
3300031710|Ga0307386_10780702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300031717|Ga0307396_10164146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1044Open in IMG/M
3300031717|Ga0307396_10660160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300031729|Ga0307391_10188349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1075Open in IMG/M
3300031729|Ga0307391_10208142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1030Open in IMG/M
3300031739|Ga0307383_10468258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300031743|Ga0307382_10269007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300031758|Ga0315907_11117769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300031784|Ga0315899_10565475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1078Open in IMG/M
3300031857|Ga0315909_10483683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea860Open in IMG/M
3300032470|Ga0314670_10209354All Organisms → cellular organisms → Eukaryota982Open in IMG/M
3300032518|Ga0314689_10245336All Organisms → cellular organisms → Eukaryota933Open in IMG/M
3300032724|Ga0314695_1152950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata869Open in IMG/M
3300032730|Ga0314699_10503202All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300032747|Ga0314712_10189799All Organisms → cellular organisms → Eukaryota967Open in IMG/M
3300033984|Ga0334989_0271849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea911Open in IMG/M
3300034019|Ga0334998_0448778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata730Open in IMG/M
3300034105|Ga0335035_0252699All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300034105|Ga0335035_0502311Not Available663Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.15%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.59%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.59%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.07%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.07%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.84%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.84%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.23%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water1.23%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.23%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat1.23%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.61%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.61%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.61%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.61%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.61%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.61%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.61%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.61%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.61%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.61%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.61%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.61%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.61%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.61%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.61%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001271Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY90Host-AssociatedOpen in IMG/M
3300002024Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5kEnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017107Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463)Host-AssociatedOpen in IMG/M
3300017210Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123)Host-AssociatedOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018613Metatranscriptome of marine microbial communities from Baltic Sea - GS846_ls3EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022745Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023439Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12EnvironmentalOpen in IMG/M
3300023442Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-SC8EnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031006Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031335Saline water microbial communities from Organic Lake, Antarctica - #374EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY90_1001637013300001271Macroalgal SurfaceVGLDVKVRELNYSLLAIQQKGGIGLRSPREYFKEWTNGNKKLDAGEFEQALGAFG*
MIS_111071713300002024Sinkhole FreshwaterAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRSLARIFKRMDFNGNKRLDAAEFE*
Ga0007751_1055289713300004794Freshwater LakeDMAFYGVGLEVKVRELNLQYKLLIQQKGGSGLRGLKKIFQRMDYNGNRKLDPTEFE*
Ga0066831_1007346533300005516MarineVAVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDYSEFE*
Ga0066831_1023048223300005516MarineMVRELNLKFKLAIQQKGGVGLRTIRRILKQFDANKNNKLDQAEFE*
Ga0068876_1023240233300005527Freshwater LakeMAFYGVGIEVKVRELNLQFKLALQQKSGTVGIRNLARIFKRMDVNGNKKLDGAEFE*
Ga0070727_1022259913300005590Marine SedimentPKTPKPHINNRLNKMAFYGVGLDVKVRELNLQFKLAIQSKGGVGLRSLKRIFNRMDFNGNKKLDHSEFEQALAAFG*
Ga0078894_1046396253300005662Freshwater LakeMAFYGVPLEVMVRELNIKFKLAIQAKGGVGIRSLKGIFKRMDENGNKTLDAGEFEQALAAFG*
Ga0078894_1053980413300005662Freshwater LakeMAFYGVGLEVKVRELNLQFKLLIQQKGGQGLRSLKKIFQRVDVNGNKKLDGSEFEQALAAFG*
Ga0078894_1064879013300005662Freshwater LakeMAFYGVNMDAMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDFNGSKTLDIGEFEQALSAFG*
Ga0078117_113733013300005758Lake WaterMSFYGVPLEVMVRELNLKFKLAIQAKGGVGLRSLKVIFNRLDVNGNKTLDGGEFEQALAAFG*
Ga0078117_113869833300005758Lake WaterMAFYGVNLDQMIRELNLKFKLAIQAKGGIGIRTLRNRFKELDYNGSKTLD*
Ga0075502_149748123300006357AqueousVNLDVMVRELNLKFKLAIQQKGGVGIRSLKLIFNRMDFNGSKGLDAGEFEQALAAFGLFPKKVEL*
Ga0075504_130082033300006383AqueousYGVNLDVMVRELNLKFKLAIQQKGGVGIRSLKLIFNRMDFNGSKGLDAGEFEQALAAFGLFPKKVELQALMKYYDVN*
Ga0075505_142215813300006571AqueousYYGVNLDVMVRELNLKFKLAIQQKGGVGIRSLKLIFNRMDFNGSKGLDAGEFEQALAAFGLFPKKVELQALMKYYDVN*
Ga0075471_1011788233300006641AqueousMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFNRMDFNGNKRLDASEFEQALAAFG*
Ga0075467_1003200423300006803AqueousMAFYGVNIDVMVRELNLKFKLAIQQKGGVGIRTLKNIFRRMDFNGNKKLDSGEFEQALAAFG*
Ga0075467_1014027833300006803AqueousMAYYGVNLDVMVRELNLKFKLAIQQKGGVGIRSLKLIFNRMDFDGSKSLDAGEFEQALAAFG*
Ga0075467_1036289213300006803AqueousMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNKRLDLSEFEQALAAFG*
Ga0075464_1025318313300006805AqueousMAFYGVPLEVMIRELNIKFKMAIQSKSGVGIRSLKNIFNKMDSNGNKSLDAGEFEQALAAFG*
Ga0075464_1041845113300006805AqueousMAYYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLKVIFNRMDYDGSKTLDGGEFEQALAAFG*
Ga0075464_1089709613300006805AqueousMAFYGVNMDVMVRELNLKFKLTIQQKGGVGLRSLANIFRRMDFNGNRKLDAGEFEQALAAFGYVSNLLTF*
Ga0102828_109324213300007559EstuarineMDVMVRELNLKFKLAIQQRGGVGIRSLKVIFNRMDYDGSKTLDGGEFEQALTAFG*
Ga0102828_119666713300007559EstuarineMAFYGVNLEVMVRELNLKFKLAIQAKGGVGIRSLKGIFSRMDENGNKTLDAGEFE*
Ga0102914_107306733300007561EstuarinePRLERSQFLKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0102902_103976533300007644EstuarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRSLKVIFRRMDFTGNRKLDSSEFEQALAAFG*
Ga0102912_108296713300007649EstuarinePKTPKPRLERSQFLKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0102900_101951133300007651EstuarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRSLKVIFRRMDFNGNRKLDSSEFEQALAAFG*
Ga0102852_110453823300007718EstuarineVNMDAMVRELNLKFKLAIQQKGGVGLRSLKVIFKRMDYNGSKSLDVGEFEQALAAFG*
Ga0114347_110970613300008114Freshwater, PlanktonKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0114351_126656913300008117Freshwater, PlanktonVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0104259_100382333300008958Ocean WaterHMCAVHMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE*
Ga0102816_104914243300008999EstuarineMAFYGVNMDAMVRELNLKFKLAIQQKGGVGLRSLKVIFKRMDYNGSKSLDVGEFEQALAAFG*
Ga0102960_127473913300009000Pond WaterMAFYGVNMDVMVRELNLKFKLAIQQKGGVGIRSLRNIFRRMDFNGNKKLDSGEFEQALAAFG*
Ga0114978_1022993113300009159Freshwater LakeMAYYGVNMDVMVRELNLKFKLAIQQRGGIGIRSLKVIFNRMDFDGSNSLDGGEFEQALAAFG*
Ga0114970_1055997123300009163Freshwater LakeMAFYGVSLEVKVRELNLQFKLLIQQKGGSGLRGLKVIFNRMDANGNKRLDSDEFEAALAAFG*
Ga0103842_100202913300009216River WaterQLTNLKFKLAIQQRGGIGIRTLALIFKRMDFNGHKKLDASEFEQALAAFGLFPKKVEI*
Ga0115005_1064973433300009432MarineMFKRNLCFGSLGIIKVQELYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGVIFKRMDFNGNKALDIGEFEQALAAFG*
Ga0115008_1043311833300009436MarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNRKLDSSEFEQALAAFG*
Ga0115008_1048952113300009436MarineMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLHVIFKRMDFNGNKVLDIGEFEQALAAFG*
Ga0115008_1053131713300009436MarineMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLKIIFNRMDFNGNRKLDAGEFEQALAAFG*
Ga0115008_1059811213300009436MarineMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE*
Ga0115008_1065358023300009436MarineMAFYGVNMDVMVRELNLKFKLQIQQKGGVGIRSLATIFKRMDFNGNKKLDIGEFEQALAAFG*
Ga0115007_1018726813300009441MarineMAFYGVNMDVMVRELNLKFKLSIQQKGGVGIRSLAIIFKRMDFNGNRKLDIGEFEQALAAFG*
Ga0115007_1129125113300009441MarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFKRMDFNGNKKLDASEFE*
Ga0129283_1021049623300009537Beach Aquifer PorewaterMAFYGVGLEVKVRELNLQFKLAIQSKGGTGLRSLKRIFMRMDFNGNKKLDAAEFE*
Ga0115099_1100631823300009543MarineNMDVMVRELNLKFKLAIQQKGGVGIRSLAIIFKRMDFNGNKKLDIGEFE*
Ga0115103_185211013300009599MarineFYGVGLDVKVRELNLQFKLAIQQKGGVGLRSLKRIFARMDFNGNKKLDCSEFEQALAAFGLFPKKVEL*
Ga0115102_1094487413300009606MarineMAFYGVQLDVAVRELNLKFKLAIQQKGGVGIRSLRRIFRQMDFNGNKRLDSSEFE*
Ga0136644_1027835413300010334Freshwater LakeMAFYGVNLEVMIRELNLKFKLAIQQKGGVGIRTLKNIFTRMDQNGNKTLDISEFE*
Ga0133913_1265258113300010885Freshwater LakeMAFYGVNLEVMVRELNLKFKLAIQAKGGVGIRSLKGIFTRMDENGNKTLDMGEFE*
Ga0133913_1318732443300010885Freshwater LakeMAFYGVPLEVAIRELNLKFKLAIQNKGGIGIHSLKGIFRRMDNNGNGILDAGEFE*
Ga0138262_164203043300012417Polar MarineLKMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDTSEFE*
Ga0163179_1061452613300012953SeawaterMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFRRMDFNGNKKLDIGEYE*
Ga0163179_1184213313300012953SeawaterMAFYGVGKDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNKKLDASEFE*
Ga0163111_1169496313300012954Surface SeawaterMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLRIIFNRMDFNGNKKLDSSEFEQALAAFG*
Ga0164293_1034686833300013004FreshwaterPKTPKPRLERSQFIKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0164293_1081200213300013004FreshwaterMAFYGVGIEVKVRELNLQFKLALQSRGGAVGIRTLGKIFKRMDINGNRKLDAAEFEQALGQFG*
Ga0164292_1055177023300013005FreshwaterPKTPKPRLERSQFIKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRALKTIFKRMDSNANKTLDAGEFEQALAAYG*
Ga0172420_1045037833300013233MarineAFYGVGLDVKVRELNLQFKLAIQSKGGVGLRSLKRIFQRMDFNGNKKLDASEFE*
Ga0170791_1510379113300013295FreshwaterGIEVKVRELNLQFKLALQSRGGAVGIRTLGKIFTRMDINGNRKLDSAEFEQALG*
Ga0186524_10922113300017107Host-AssociatedMAFYGVNLDVMVRELNLKFKLSIQQKGGVGIRSLKRIFDRMDFNGNKKLDSGEFEQALAAFGLFPKKVEL
Ga0186339_10711113300017210Host-AssociatedMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNRKLDTSEFEQALAAFG
Ga0186220_11084013300017262Host-AssociatedMAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRSLARIFKRMDFNGNKKLDA
Ga0169931_1033507733300017788FreshwaterMAFYGVGIEVKVRELNLQFKLALQQKSGAVGIRSLARIFRRMDVNGNRKLDASEFEQALATFG
Ga0169931_1102855623300017788FreshwaterMAFYGVNLDQMIRELNLKFKLAIQAKGGIGIRVLRKRFKDLDLNGSKTLD
Ga0181561_1019005613300018410Salt MarshCIMAYYGVNMDAMVRELNLKFKLAIQQKGGVGLRSLKVIFKRMDFNGNNTLDIGEFE
Ga0188872_100948023300018613Freshwater LakeGVNMDTMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDFNGNNTLDIGEFE
Ga0192983_100565213300018684MarineMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0192984_106864413300018710MarineETSTYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0192974_101125313300018739MarineFTSIRETSTYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0192989_1004030113300018926MarineKSLEMAFYGVSRDVMVRELNLKFKLAIQQRGGIGIRTLALIFKRMDFNGNKKLDASEFEQALAAFGLFPKKVEI
Ga0193531_1010874833300018961MarineLSMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNKKLDTSEFE
Ga0192894_1008097033300018968MarineMAFYGVNLDVMVRELNLKFKLAIQQKGGVGIRSLGRIFRRMDFNGNKKLDAGEFEQALAAFGLFPKKVEL
Ga0193569_1013692633300019017MarineSLSMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNKKLDTSEFE
Ga0192982_1003209033300019021MarineTWGIFTSIRETSTYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0192982_1007373233300019021MarineMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDTSEFE
Ga0192972_101455213300019108MarineSIRETSTYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0192975_1006696313300019153MarineIFTSIRETSTYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0180032_102794123300019201EstuarineAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAY
Ga0211734_1043268713300020159FreshwaterMAFYGVNKDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGSRTLDASKFEQALAAFG
Ga0211733_1124903513300020160FreshwaterPKTPKPRLERSQFIKTKNMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG
Ga0194115_1017406133300020183Freshwater LakePKTPKPRLQRLQFNKTENMAFCGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAFG
Ga0194115_1018134913300020183Freshwater LakeMAFYGVNMDAMVRELNLKFKLAIQQKGGIGLRSLKLIFKRMDFNSSKTLDIGEFE
Ga0211731_1097055143300020205FreshwaterMAFYGVGIEVKVRELNLQFKLALQSRGGAVGIRTLGKIFKRMDINGNRKLDSAEFEQALGQFG
Ga0194132_1054338013300020214Freshwater LakeMAYYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLKVIFDRMDYNRSKSLDAGEFEQALASFG
Ga0194133_1023368913300021091Freshwater LakeMSFYGVPLEVAVRELNLKFKLAIQAKGGVGIRSLKVIFKRLDVNGNKSLDIGEFEQALAAFG
Ga0214162_102048833300021108FreshwaterMAFYGVPLEVLVRELNIKFKIAIQAKGGVGIRSLKGIFKRMDENGNKTLDVGEFEQALAAFG
Ga0210307_128448033300021336EstuarineMAFYGVNMDAMVRELNLKFKLAIQQKGGVGLRSLKVIFKRMDYNGSKSLDVGEFEQALAAFG
Ga0206692_104334833300021350SeawaterAFYGVPLEVIVRELSLKFRTAIQSKGGNGIRSLKRIFARMDENGNKTLDESEFEQALAAFGLFPKKVEL
Ga0206692_190335923300021350SeawaterMAFYGVQLDVAVRELNLKFKLAIQQKGGVGIRSLRRIFRQMDFNGNKRLDSSEFE
Ga0206693_112419113300021353SeawaterDKFRLTQMAFYGVNMDVMVRELNLKFKLAIQQKGGVGIRSLATIFRRMDFNGNKKLDIGEFE
Ga0063107_10362213300021869MarineRLVHMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0063105_100083213300021887MarineVHMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0063089_100360513300021889MarineLVHMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0063136_106091613300021896MarineEMAFYGVSRDVMVRELNLKFKLAIQQRGGIGIRTLALIFKRMDFNGNKKLDASEFEQALAAFGLFPKKVEI
Ga0063097_104320113300021898MarineAFYGVGLDVKVRELNLQFKLAIQQKGGVGLRSLKRIFMRMDFNGNKKLDCSEFEQALAAFGLFPKKVEL
Ga0063134_104661113300021928MarineVKSLEMAFYGVSRDVMVRELNLKFKLAIQQRGGIGIRTLALIFKRMDFNGNKKLDASEFEQALAAFGLFPKKVEI
Ga0063102_104147113300021941MarineMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0063755_103839713300021954MarinePMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFKRMDFNGNKKLDASEFE
Ga0228698_114110323300022745FreshwaterMAFYGVNLEVKVRELNLHFKLALQQKGGAVGLRSLARIFTRMDANGNKKLDASEFEQALAAFGYIVIC
(restricted) Ga0233412_1043953613300023210SeawaterMAFYGVQLDVMVRELNLKFKLAVQQKGGVGIRSLKRIFNQMDFNGNKKLDASEFE
Ga0256752_104240633300023439Hydrothermal Fe-Rich MatMAFYGVGLDVKVRELNLQFKLAIQSKGGVGLRSLKRIFQRMDFNGNKKLDASEFE
Ga0256751_109997823300023442Hydrothermal Fe-Rich MatMAFYGVGCEVKVKELLLQIKMQIQNKPGRGIRYLKVIFRRYDENGNKKLDPVEFEECLNAFG
(restricted) Ga0233437_139059013300024259SeawaterLDVAVEELNLQFKIAIKKKGGLGIRSLARIFKRMDFNGNKKLDMEEFTEALGAFG
Ga0244777_1052111923300024343EstuarinePKTPKPRLERSQFLKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG
Ga0244777_1080533823300024343EstuarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRSLKVIFRRMDFNGNRKLDSSEFEQALAAFG
Ga0244775_1116151023300024346EstuarineMDVMVRELNLKFKLAIQQRGGVGIRSLKVIFNRMDYDGSKTLDGGEFEQALTAFG
Ga0208005_104044933300025848AqueousMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFNRMDFNGNKRLDASEFEQALAAFG
Ga0208544_10005092113300025887AqueousMAFYGVNIDVMVRELNLKFKLAIQQKGGVGIRTLKNIFRRMDFNGNKKLDSGEFEQALAAFG
Ga0208544_1009042413300025887AqueousMAYYGVNLDVMVRELNLKFKLAIQQKGGVGIRSLKLIFNRMDFDGSKSLDAGEFEQALAAFG
Ga0208916_1022447913300025896AqueousMAFYGVPLEVMIRELNIKFKMAIQSKSGVGIRSLKNIFNKMDSNGNKSLDAGEFEQALAAFG
Ga0208275_102672813300026182MarineVAVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDYSEFE
Ga0208177_109889523300027254EstuarineMVRELNLKFKLAIQQRGGVGIRSLKVIFNRMDYDGSKTLDGGEFEQALAAFG
Ga0208966_105147523300027586Freshwater LenticMAFYGVNLDQMVRELNLKFKLAIQAKGGVGIRTLRQRFKELDFNGSKTLD
Ga0209617_1009657613300027720Freshwater And SedimentMAFYGVGIEVKVRELNLQFKLALQSRGGAVGIRTLGKIFKRMDINGNRKLDSAEFEQALG
Ga0209598_1012567923300027760Freshwater LakeMAFYGVGIEVKVRELNLQFKLALQQKSGTVGIRNLARIFKRMDVNGNKKLDGAEFE
Ga0209500_1013819233300027782Freshwater LakeMAYYGVNMDVMVRELNLKFKLAIQQRGGIGIRSLKVIFNRMDFDGSNSLDGGEFEQALAAFG
Ga0209302_1009108643300027810MarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFKRMDFNGNKKLDASEFE
Ga0209302_1011621613300027810MarineMAFYGVNMDVMVRELNLKFKLSIQQKGGVGIRSLAIIFKRMDFNGNRKLDIGEFEQALAAFG
Ga0209092_1019550133300027833MarineMAFYGVPLEVMVRELNIKFKLAIQTKGGIGVRSLKHIFRRMDANGNKALDVSEFEQALGAFG
Ga0209092_1031548913300027833MarineMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLKIIFNRMDFNGNRKLDAGEFEQALAAFG
Ga0209092_1058750723300027833MarineMAFYGVNQDVMVRELNLRFKLAIQQKGGVGLRTLKVIFRRMDFNGNRKLDSSEFEQALAAFG
Ga0209712_1039169833300027849MarineFGSLGIIKVQELYMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGVIFKRMDFNGNKALDIGEFEQALAAFG
Ga0247566_104834113300028335SeawaterEEMAFYGVPLEVIVRELSLKFRTAIQSKGGNGIRSLKRIFARMDENGNKTLDESEFEQALAAFGLFPKKVEL
Ga0311341_1040310133300029908BogMAFYGVGLEVKVRELNLQFKLAIQQKGGVGLRTLAVIFRRMDYNGNKKLDASE
Ga0311362_1128331313300029913BogMAFYGVGLEVKVRELNLQFKLAIQQKGGVGLRTLAVIFRRMDYNGNKKLDASEFEQALAAFG
Ga0247613_1024302233300030610SoilAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRSLAKIFQRMDFNGNKKLDAAEFE
Ga0210291_1023167723300030626SoilVSLEVKVRELNLQFKLAIQSKGGNGLRNLKCILQRFDIEGRGKLDSSEFEQALAAFGVFPKKVEL
Ga0210291_1045710633300030626SoilAFYGVGLDVKVRELNLQFKLTIQQKGGIGLRSLAKIFQRMDFNGNKKLDAAEFE
Ga0307401_1008765323300030670MarineMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLRIIFNRMDFNGNRKLDSSEFEQALAAFG
Ga0307398_1038711123300030699MarineMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEYE
Ga0307400_1031211313300030709MarineQIFDMAFYGVNLDVMVRELNLKFKLAVQQKGGVGIRSLKHIFTRMDFNGSKALDAGEFEQALAAFGLPQEG
Ga0307400_1085900313300030709MarineSSMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLRIIFNRMDFNGNRKLDSSEFEQALAAFG
Ga0265460_1069274433300030740SoilNLQFKLAIQSKGGNGLRNLKCILQRFDIEGRGKLDSSEFEQALAAFGVFPKKVEL
Ga0265459_1081790733300030741SoilDFYGVGLDVKVRELNLQFKLTIQQKGGIGLRSLAKIFQRMDFNGNKKLDASEFE
Ga0073966_1167493223300030786MarineMDVMVRELNLKFKLAIQQKGGVGLRSLRRIFRQMDFNGNKKLDAGEFE
Ga0073964_1161968923300030788MarineMAFYGVNQDVMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDLNGNRQLD
Ga0073977_100130823300030948MarineAFYGVNQDVMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDLNGNRQLD
Ga0073974_101589013300031005MarineMAFYGVNQDVMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDINGNRQLD
Ga0073973_173127413300031006MarineKMAFYGVNQDVMVRELNLKFKLAIQQKGGVGLRSLKLIFKRMDLNGNRQLD
Ga0170834_10394043523300031057Forest SoilAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRTLFKIFQRMDFNGNKKLDAAEFE
Ga0307951_105154743300031335Saline WaterMAFYGVGLDVKVRELNLQFKLAIQAKGGVGLRSLARIFKRVDFNGNKKLDAAEFEQALAAFG
Ga0307489_1082520613300031569Sackhole BrineVMVRELNLKFKLAIQQKGGVGIRSLRRIFTQMDFNGNKSLDLSEFE
Ga0307386_1078070213300031710MarineVNMDVMVRELNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0307396_1016414623300031717MarineQMAFYGVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEFE
Ga0307396_1066016023300031717MarineTSSMAFYGVNQDVMVRELNLKFKLAIQQKGGVGIRTLRIIFNRMDFNGNRKLDSSEFEQALAAFG
Ga0307391_1018834913300031729MarineTQMAFYGVNMDVMVREMNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0307391_1020814233300031729MarineVNMDVMVRELNLKFKLAIQQRGGVGIRSLGTIFKRMDFNGNKKLDIGEYE
Ga0307383_1046825823300031739MarineMAFYGVNMDVMVREMNLKFKLAIQQRGGVGIRSLATIFKRMDFNGNKKLDIGEFE
Ga0307382_1026900713300031743MarineMAFYGVNMDVMVRELNLKFKLAIQQKGGVGIRSLAIIFKRMDFNGNKKLDIGEFE
Ga0315907_1111776923300031758FreshwaterPKTPKPRLERSQFIKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG
Ga0315899_1056547533300031784FreshwaterPRLERSQFIKTENMAFYGVPLEVMVRELNIKFKLAIQNKGGNGIRSLKTIFKRMDSNANKTLDAGEFEQALAAYG
Ga0315909_1048368313300031857FreshwaterMAFYGVNMDVMVRELNLKFKLTIQQKGGVGLRSLANIFRRMDFNGNKKLDAGEFEQALAAFGYVSISLTF
Ga0314670_1020935413300032470SeawaterMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDISEFE
Ga0314689_1024533633300032518SeawaterFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDISEFE
Ga0314695_115295013300032724SeawaterKMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKN
Ga0314699_1050320213300032730SeawaterKMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDISEFE
Ga0314712_1018979913300032747SeawaterNKMAFYGVQLDVMVRELNLKFKLAIQQKGGVGIRSLRRIFNQMDFNGNKKLDISEFE
Ga0334989_0271849_95_2293300033984FreshwaterMAYYGVNVTQMVQELNLKFKVAIQQKGGNGLRGLRLCMKRLDYN
Ga0334998_0448778_55_2433300034019FreshwaterMAFYGVNMDAMVRELNLKFKLAIQQKGGIGLRSLKLIFKRMDFNGSKTLDIGEFEQALSAFG
Ga0335035_0252699_839_10063300034105FreshwaterMAFYGVPLEVMVRELNLKFKLAIQAKGGVGIRSLKGIFKRMDENGNKTLDMGEFE
Ga0335035_0502311_498_6563300034105FreshwaterLVRELNIKFKIAIQAKGGVGIRSLKGIFKRMDENGNKTLEVGEFEQALAAFG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.