NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034341

Metagenome / Metatranscriptome Family F034341

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034341
Family Type Metagenome / Metatranscriptome
Number of Sequences 175
Average Sequence Length 73 residues
Representative Sequence MELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKN
Number of Associated Samples 146
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 23.43 %
% of genes near scaffold ends (potentially truncated) 41.14 %
% of genes from short scaffolds (< 2000 bps) 95.43 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(45.714 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(45.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.94%    β-sheet: 0.00%    Coil/Unstructured: 53.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 175 Family Scaffolds
PF01344Kelch_1 24.57
PF00643zf-B_box 11.43
PF13418Kelch_4 6.86
PF13964Kelch_6 6.86
PF13415Kelch_3 1.14
PF15227zf-C3HC4_4 0.57



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2043231002|Landsort10m_GCH9ZVC01C1A81All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10047249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1120Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10156896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10027974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1965Open in IMG/M
3300000243|SA_S2_NOR18_50mDRAFT_1038535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300002305|B570J29619_1004423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1131Open in IMG/M
3300002835|B570J40625_100226475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1985Open in IMG/M
3300003860|Ga0031658_1021551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1083Open in IMG/M
3300004112|Ga0065166_10018450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2019Open in IMG/M
3300004112|Ga0065166_10040253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1505Open in IMG/M
3300004463|Ga0063356_101841890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae910Open in IMG/M
3300004690|Ga0065175_1006476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea838Open in IMG/M
3300004777|Ga0007827_10028356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1349Open in IMG/M
3300004788|Ga0007742_10003597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300005459|Ga0068867_101802546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae575Open in IMG/M
3300005662|Ga0078894_10187329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1871Open in IMG/M
3300005662|Ga0078894_10351454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1335Open in IMG/M
3300005662|Ga0078894_11698424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300005941|Ga0070743_10081558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1092Open in IMG/M
3300005941|Ga0070743_10106681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani941Open in IMG/M
3300005987|Ga0075158_10129092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1462Open in IMG/M
3300005987|Ga0075158_10238781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1039Open in IMG/M
3300005987|Ga0075158_10285944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae937Open in IMG/M
3300005989|Ga0075154_10165662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1280Open in IMG/M
3300006056|Ga0075163_10279089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1909Open in IMG/M
3300006072|Ga0007881_1110528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae683Open in IMG/M
3300006165|Ga0075443_10046251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1460Open in IMG/M
3300006165|Ga0075443_10071350All Organisms → cellular organisms → Eukaryota1178Open in IMG/M
3300006165|Ga0075443_10414997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300006641|Ga0075471_10128044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1352Open in IMG/M
3300006803|Ga0075467_10102611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1700Open in IMG/M
3300006803|Ga0075467_10335957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani797Open in IMG/M
3300006805|Ga0075464_10069735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1978Open in IMG/M
3300006874|Ga0075475_10174195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani933Open in IMG/M
3300007171|Ga0102977_1015109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1913Open in IMG/M
3300007236|Ga0075463_10044057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1450Open in IMG/M
3300007981|Ga0102904_1067194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea824Open in IMG/M
3300008111|Ga0114344_1077367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1914Open in IMG/M
3300008119|Ga0114354_1181173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300008121|Ga0114356_1546633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300008262|Ga0114337_1058751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1966Open in IMG/M
3300008262|Ga0114337_1338869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300008264|Ga0114353_1262470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1182Open in IMG/M
3300008952|Ga0115651_1099626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2165Open in IMG/M
3300009002|Ga0102810_1162111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300009050|Ga0102909_1141677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300009080|Ga0102815_10771158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300009142|Ga0102885_1013474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1891Open in IMG/M
3300009155|Ga0114968_10092551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1859Open in IMG/M
3300009155|Ga0114968_10155872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1352Open in IMG/M
3300009159|Ga0114978_10202342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1254Open in IMG/M
3300009218|Ga0103848_1101917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300009247|Ga0103861_10019815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea908Open in IMG/M
3300009422|Ga0114998_10210614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300009422|Ga0114998_10512589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300009434|Ga0115562_1208987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300009436|Ga0115008_10611802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300009436|Ga0115008_11430418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300009495|Ga0115571_1182957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300009497|Ga0115569_10183138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani978Open in IMG/M
3300009497|Ga0115569_10235565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300009526|Ga0115004_10223173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1125Open in IMG/M
3300009544|Ga0115006_10531915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1030Open in IMG/M
3300009599|Ga0115103_1106937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani914Open in IMG/M
3300009599|Ga0115103_1155297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1026Open in IMG/M
3300009785|Ga0115001_10215805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1237Open in IMG/M
3300010354|Ga0129333_10176300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1953Open in IMG/M
3300010388|Ga0136551_1040219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae865Open in IMG/M
3300010389|Ga0136549_10302037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300012408|Ga0138265_1089108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1455Open in IMG/M
3300012415|Ga0138263_1602869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani930Open in IMG/M
3300012419|Ga0138260_10727209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1150Open in IMG/M
3300012471|Ga0129334_1052823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300012943|Ga0164241_10233483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1315Open in IMG/M
3300012952|Ga0163180_10285953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1166Open in IMG/M
3300012952|Ga0163180_10397615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1007Open in IMG/M
3300012952|Ga0163180_10557591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300012954|Ga0163111_11959158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300012954|Ga0163111_12417313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300012970|Ga0129338_1258944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii723Open in IMG/M
3300013004|Ga0164293_10057527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3107Open in IMG/M
3300013006|Ga0164294_10557222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae778Open in IMG/M
3300013006|Ga0164294_10775449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea646Open in IMG/M
3300013010|Ga0129327_10373678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea751Open in IMG/M
3300013296|Ga0157374_10497933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1223Open in IMG/M
(restricted) 3300014720|Ga0172376_10357687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae851Open in IMG/M
3300015360|Ga0163144_11314120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae652Open in IMG/M
3300016740|Ga0182096_1251432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea793Open in IMG/M
3300016740|Ga0182096_1330239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300017166|Ga0186523_102046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2117Open in IMG/M
3300017238|Ga0186197_102873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1838Open in IMG/M
3300017262|Ga0186220_104373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1827Open in IMG/M
3300017748|Ga0181393_1017157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2140Open in IMG/M
3300017788|Ga0169931_10159286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2008Open in IMG/M
3300018414|Ga0194135_10763261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300018684|Ga0192983_1059747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300018980|Ga0192961_10143418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300018982|Ga0192947_10011087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2115Open in IMG/M
3300018999|Ga0193514_10058820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1333Open in IMG/M
3300019017|Ga0193569_10337157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300019021|Ga0192982_10385277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300019022|Ga0192951_10386063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea531Open in IMG/M
3300019048|Ga0192981_10086460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1210Open in IMG/M
3300019048|Ga0192981_10158490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300019048|Ga0192981_10277632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea633Open in IMG/M
3300019048|Ga0192981_10303417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300019103|Ga0192946_1013699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1161Open in IMG/M
3300020048|Ga0207193_1231718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1418Open in IMG/M
3300020048|Ga0207193_1364816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea980Open in IMG/M
3300020074|Ga0194113_10557287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300020159|Ga0211734_10212141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300020179|Ga0194134_10071918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1797Open in IMG/M
3300020197|Ga0194128_10192778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1105Open in IMG/M
3300020204|Ga0194116_10131344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1539Open in IMG/M
3300020204|Ga0194116_10476750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae594Open in IMG/M
3300020546|Ga0208853_1010554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1985Open in IMG/M
3300021091|Ga0194133_10132013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1826Open in IMG/M
3300021355|Ga0206690_10627521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300021359|Ga0206689_11017206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300021365|Ga0206123_10089852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1486Open in IMG/M
3300021950|Ga0063101_1082408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300023179|Ga0214923_10097067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2003Open in IMG/M
3300024343|Ga0244777_10100226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1870Open in IMG/M
3300024346|Ga0244775_10174862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1807Open in IMG/M
3300024346|Ga0244775_10412164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1110Open in IMG/M
3300025626|Ga0209716_1147626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300025699|Ga0209715_1139692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani831Open in IMG/M
3300025840|Ga0208917_1121295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani934Open in IMG/M
3300025872|Ga0208783_10321904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300025890|Ga0209631_10109827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1568Open in IMG/M
3300025896|Ga0208916_10141459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1031Open in IMG/M
3300025897|Ga0209425_10434055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300026075|Ga0207708_11900726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae522Open in IMG/M
3300027243|Ga0208174_1031533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii670Open in IMG/M
3300027760|Ga0209598_10337649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300027781|Ga0209175_10195584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae864Open in IMG/M
3300027789|Ga0209174_10167260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae999Open in IMG/M
3300027805|Ga0209229_10105362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1271Open in IMG/M
3300027805|Ga0209229_10366540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea628Open in IMG/M
3300027833|Ga0209092_10273223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani923Open in IMG/M
3300027885|Ga0209450_11202107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300027899|Ga0209668_10453598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea845Open in IMG/M
3300027963|Ga0209400_1156233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium988Open in IMG/M
(restricted) 3300027997|Ga0255057_10145439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1150Open in IMG/M
3300030709|Ga0307400_10131272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1504Open in IMG/M
3300030860|Ga0074000_10052517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae959Open in IMG/M
3300030948|Ga0073977_1630392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea883Open in IMG/M
3300031036|Ga0073978_1583977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1996Open in IMG/M
3300031558|Ga0308147_1039192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300031602|Ga0307993_1061841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani943Open in IMG/M
3300031638|Ga0302125_10043459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1549Open in IMG/M
3300031710|Ga0307386_10317425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea786Open in IMG/M
3300031722|Ga0311351_11084821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae614Open in IMG/M
3300031729|Ga0307391_10453944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300031735|Ga0307394_10409737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300031737|Ga0307387_10150510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1279Open in IMG/M
3300031737|Ga0307387_10572440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300031742|Ga0307395_10483047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300032050|Ga0315906_10416975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1163Open in IMG/M
3300032463|Ga0314684_10470656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300032470|Ga0314670_10568818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300032481|Ga0314668_10602618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300032519|Ga0314676_10348630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani876Open in IMG/M
3300032520|Ga0314667_10030995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1911Open in IMG/M
3300032522|Ga0314677_10124195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1219Open in IMG/M
3300032650|Ga0314673_10144729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1097Open in IMG/M
3300032723|Ga0314703_10217351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300032728|Ga0314696_10676533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300032732|Ga0314711_10378921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300032742|Ga0314710_10396378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300032742|Ga0314710_10418773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300032747|Ga0314712_10119161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1196Open in IMG/M
3300032820|Ga0310342_102991484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300034051|Ga0335024_0313375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani802Open in IMG/M
3300034094|Ga0335014_0164137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1076Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.57%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.00%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.43%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.43%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.86%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine2.29%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.71%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.71%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.71%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.71%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.14%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.14%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.14%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.14%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.14%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.14%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.14%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.57%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.57%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.57%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.57%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.57%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.57%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.57%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.57%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.57%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.57%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.57%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
204323100210 m water depthEnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000243Svalbard Archipelago station 2 sample NOR 18_50mEnvironmentalOpen in IMG/M
3300002305Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004690Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (version 2)EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008121Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTREnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300009247Microbial communities of water from Amazon river, Brazil - RCM14EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018414Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030860Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034094Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
10m_8371302043231002MarineMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSSIFQ
SA_S1_NOR05_45mDRAFT_1004724913300000127MarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGP
SA_S2_NOR15_50mDRAFT_1015689623300000130MarineMIEDQRNELKQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
KGI_S1_ANT02_95mDRAFT_1002797423300000136MarineMIEDQRSELKQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKN*
SA_S2_NOR18_50mDRAFT_103853513300000243MarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKNQANIYLFGDDI
B570J29619_100442313300002305FreshwaterMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVS*
B570J40625_10022647533300002835FreshwaterMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKGT*
Ga0031658_102155123300003860Freshwater Lake SedimentLKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0065166_1001845023300004112Freshwater LakeMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQS*
Ga0065166_1004025323300004112Freshwater LakeMTFSTFFEKKKKDLKMLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSS*
Ga0063356_10184189023300004463Arabidopsis Thaliana RhizosphereMDHYTDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPQMTRVS*
Ga0065175_100647613300004690FreshwaterDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0007827_1002835633300004777FreshwaterMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQ*
Ga0007742_1000359733300004788Freshwater LakeIEDQRTELKQAVAKMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNRGPKN*
Ga0068867_10180254613300005459Miscanthus RhizosphereVSNRQELTQSLHCMDIYTDDMTFNTFHEKKKKDLKVLNVLNDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSMIRVSKQ*
Ga0078894_1018732933300005662Freshwater LakeMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0078894_1035145423300005662Freshwater LakeLNAVDFYTDDMTFSTFFERKKKDIKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKN*
Ga0078894_1169842413300005662Freshwater LakeMIDEQRTELKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0070743_1008155813300005941EstuarineELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKN*
Ga0070743_1010668123300005941EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKN*
Ga0075158_1012909223300005987Wastewater EffluentMEHYTDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPQMTRVSINRHYN*
Ga0075158_1023878133300005987Wastewater EffluentLNCQDIYTDDMTFNTYYEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPQMTRVI*
Ga0075158_1028594423300005987Wastewater EffluentLTTALGNMEHYTDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETL
Ga0075154_1016566223300005989Wastewater EffluentLNCQDIYTDDMTFNTYYEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFP*
Ga0075163_1027908923300006056Wastewater EffluentLTTALGNMEHYTDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPQMTRVSINRHYN*
Ga0007881_111052813300006072FreshwaterVANRAELTSSIAAVDFYTDDMTFSTFFERKKKDIKMLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLVKNQQQQSNIYL
Ga0075443_1004625123300006165MarineMIEDQRNELKQAINKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0075443_1007135023300006165MarineMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRN*
Ga0075443_1041499723300006165MarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0075471_1012804413300006641AqueousMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSPC*
Ga0075467_1010261133300006803AqueousMASFKNMELYSNEVNFNLFYDKKRKELKSLQMLNEFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKVSRQN*
Ga0075467_1033595713300006803AqueousMELYSFEVNFNLFYDKKRREIKQLHMLNEFVKPNPYFIYYMFKDTIHVDDYGSIKETLFKFPTLNKVSTHS
Ga0075464_1006973533300006805AqueousVNFNLFYDKKRREIKNLLSLNDFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPTLNKVRIIHKNLYRLAK*
Ga0075475_1017419523300006874AqueousMALNNMELYSDEIKFNLFHDKKRKDLKMLTVLNDFVKPSTHFVYYMFKDSIHVDDYGSIKETLFKFPSMIKNSSN*
Ga0102977_101510943300007171Freshwater LakeLFYEKKRRDIVNLQTLNEFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPTLNKVSII*
Ga0075463_1004405713300007236AqueousMIEDQRSELKQAVSKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0102904_106719413300007981EstuarineMELYASENNFNIFYEKKRRELKNLQLLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRVSTAFSPYIHFFLPDDTQ*
Ga0114344_107736723300008111Freshwater, PlanktonMEREKMIDEQRTELKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0114354_118117323300008119Freshwater, PlanktonMIEDQRTELKQAVAKMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNRGPKN*
Ga0114356_154663313300008121Freshwater, PlanktonMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSLTHSNPL*
Ga0114337_105875143300008262Freshwater, PlanktonFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKN*
Ga0114337_133886923300008262Freshwater, PlanktonNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0114353_126247023300008264Freshwater, PlanktonDEQRTELKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0115651_109962633300008952MarineMNKMELYQDEVRFNLFHEKKQKDLKILQALNEFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0102810_116211123300009002EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKNQANIYLFG
Ga0102909_114167713300009050EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLF
Ga0102815_1077115823300009080EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKNQANIYLFGDDINS
Ga0102885_101347423300009142EstuarineMELYASENNFNIFYEKKRRELKNLQLLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRVSTAFSPYIHFFVPDDTQ*
Ga0114968_1009255113300009155Freshwater LakeMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSQ*
Ga0114968_1015587223300009155Freshwater LakeMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0114978_1020234243300009159Freshwater LakeMKNMELYSFEVNFNLFYDKKRKEIKQLQMLNEFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLNKVG*
Ga0103848_110191723300009218River WaterMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLF
Ga0103861_1001981523300009247River WaterMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKD*
Ga0114998_1021061413300009422MarineMIEDQRNELKQAVNKMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNR
Ga0114998_1051258913300009422MarineLVAQFKNMELYSSDINFNIFYEKKRKELQELGRLNTFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLNKNSNN*
Ga0115562_120898713300009434Pelagic MarineDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0115008_1061180213300009436MarineMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKSS*
Ga0115008_1143041823300009436MarineMIEDQRSELRQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKNHANIYLFGDDINSKV
Ga0115571_118295723300009495Pelagic MarineMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS*
Ga0115569_1018313823300009497Pelagic MarineMELYQDENRFNIFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDFGSIKETLFK
Ga0115569_1023556523300009497Pelagic MarineMIEDQRSELKQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPRN*
Ga0115004_1022317323300009526MarineMELYQDENRFNIFHEKKRKDLKILSALNEFIKPSPYFAYYMFKDTIHVDDYGSIKETLFKFPSLDRGSKSKA
Ga0115006_1053191513300009544MarineKMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN*
Ga0115103_110693713300009599MarineVRFNLFHEKKRKDLKILAALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPS
Ga0115103_115529713300009599MarineMIEDQRSELRQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0115001_1021580523300009785MarineMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFK
Ga0129333_1017630013300010354Freshwater To Marine Saline GradientMELYQDENRFNLFHEKKRKDLKILTALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNKGPKS*
Ga0136551_104021913300010388Pond Fresh WaterMTFSTFFEKKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKN
Ga0136549_1030203713300010389Marine Methane Seep SedimentKNDLTASFKNMELYSNEVNFNLFYDKKRKELKSLQMLNEFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKVSIYLMS*
Ga0138265_108910823300012408Polar MarineMDIYASDINFNIFYDKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNANNSARIFLFGDDVN*
Ga0138263_160286913300012415Polar MarineMDIYASDINFNIFYDKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSN
Ga0138260_1072720913300012419Polar MarineIGDQKQDLIGQYKNMEIYTSDINFNIFYDKKRKDLKALQQLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSN*
Ga0129334_105282323300012471AqueousMELYSNENSFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKGT*
Ga0164241_1023348313300012943SoilMDIYTDDMTFNTFYDQKKKDVKMLNVLTDFVKPNAYFVYYMFKDTIHVDDYGSIKETLFKFPPMIKVPSFLL*
Ga0163180_1028595313300012952SeawaterMIEDQRNELKQSINKMELYQDEVRFNLFHEKKRKDLKILQALNEFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN*
Ga0163180_1039761533300012952SeawaterMELYSNENNFNIFYEKKRRDLKNLQMLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKGTSN*
Ga0163180_1055759123300012952SeawaterMELYQDKVRFNLFHEKKRKDLNILSALNEFIKPNPYFVYYMFKDTIHVDDFGSIKETLFKFPSLNSGK*
Ga0163111_1195915813300012954Surface SeawaterKMELYQDENRFNIFHEKKRKDLKILQALNDFIRPSPYFVYYMFKDTIHVDDFGSIKETLFKFPSLNKGPRN*
Ga0163111_1241731313300012954Surface SeawaterMELYQDEVRFNIFHEKKRKDLKVLSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPS
Ga0129338_125894413300012970AqueousVKNRELYSNEHSFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKGT*
Ga0164293_1005752743300013004FreshwaterMTFSTFYERKKKDLKMLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSQ*
Ga0164294_1055722213300013006FreshwaterMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSS*
Ga0164294_1077544923300013006FreshwaterFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSQ*
Ga0129327_1037367823300013010Freshwater To Marine Saline GradientMDLYSSENNFNIFYEKKRRDLKNLQQLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMNRVSKFTISAKHNY*
Ga0157374_1049793323300013296Miscanthus RhizosphereMDIYTDDMTFNTFHEKKKKDLKVLNVLNDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSMIRVSKQ*
(restricted) Ga0172376_1035768723300014720FreshwaterVDFYTDDMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKN*
Ga0163144_1131412023300015360Freshwater Microbial MatMDIYSDDMTFNTYFEKKKKDLKVLNVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPAMAKVRK*
Ga0182096_125143213300016740Salt MarshDEVRFNLFNEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0182096_133023923300016740Salt MarshMIEDQRSELKQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKF
Ga0186523_10204633300017166Host-AssociatedMELYASENNFNIFYEKKRRELRNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGSQN
Ga0186197_10287323300017238Host-AssociatedMDIYTDDMTFNTFYEQKKKDLKILSALNEFVKPNPYFVYYMFKDTIHVDDYGSIKETNFKFPSMNKNSN
Ga0186220_10437333300017262Host-AssociatedMDIYSDDMTFNTFYEQKKKDLKILSALNEFVKPNPYFIYYMFKDTIHVDDYGSIKETHFKFPSMNKS
Ga0181393_101715733300017748SeawaterMELYQDENRFNIFHEKKRKDLKILQALNDFIRPSPYFVYYMFKDTIHVDDFGSIKETLFKFPSLNKGPKS
Ga0169931_1015928633300017788FreshwaterLFYEKKRRDIVALQTLNEFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPALTKVCYHL
Ga0194135_1076326113300018414WatershedsDMTFNTFYDQKKKDLKMLSVLTDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSMTKVLNSFINFI
Ga0192983_105974723300018684MarineMEIYTSDINFNIFYDKKRKDLKALQQLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSN
Ga0192961_1014341813300018980MarineMIEDQRNELKQAINKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0192947_1001108723300018982MarineMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKS
Ga0193514_1005882023300018999MarineMELYASENNFNIFYERKRRELKNLQQLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGAQN
Ga0193569_1033715723300019017MarineMELYASENNFNIFYEKKRRELKNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGA
Ga0192982_1038527713300019021MarineMELYQDEVRFNLFHEKKRKDMKILSALNDFVKPNQYFVYYLFKDTIHVDDYGSIKETLFKFPSLNRGPKNQANIYLFGDDIN
Ga0192951_1038606313300019022MarineDINFNIFYEKKCKDLKALHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNANNSARIFLFGDDVN
Ga0192981_1008646023300019048MarineMELYASEINFNVFYEKKRRELRNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGSQN
Ga0192981_1015849033300019048MarineMDIYASDINFNIFYDKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNA
Ga0192981_1027763213300019048MarineMDIYTSDINFNIFYEKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKFNANNSARIFLFGDDVN
Ga0192981_1030341713300019048MarineMDIYASDINFNIFYDKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNANNSA
Ga0192946_101369913300019103MarineMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFP
Ga0207193_123171823300020048Freshwater Lake SedimentLKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS
Ga0207193_136481613300020048Freshwater Lake SedimentELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVS
Ga0194113_1055728713300020074Freshwater LakeMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0211734_1021214113300020159FreshwaterVNFNLFYEKKRRDIVNLQTLNEFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPTLNKVSKTXI
Ga0194134_1007191823300020179Freshwater LakeMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVNLVKH
Ga0194128_1019277823300020197Freshwater LakeMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSSIQPNPL
Ga0194116_1013134433300020204Freshwater LakeMKNMELYSNEVNFNLFYDNKRKEIKQLQMLNDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLIKVSFPF
Ga0194116_1047675013300020204Freshwater LakeMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKN
Ga0208853_101055423300020546FreshwaterMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKGT
Ga0194133_1013201323300021091Freshwater LakeMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVNLIKH
Ga0206690_1062752123300021355SeawaterMIEDQRNELKQAVNKMELYQDEVRFNLFHEKKIKDLKILSALNDFIKPNPYFLNYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0206689_1101720613300021359SeawaterMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNR
Ga0206123_1008985213300021365SeawaterMIEDQRSELKQAVSKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0063101_108240813300021950MarineVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0214923_1009706733300023179FreshwaterMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNRGPKN
Ga0244777_1010022623300024343EstuarineMELYASENNFNIFYEKKRRELKNLQLLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRVSTAFSPYIHFFLPDDTQ
Ga0244775_1017486223300024346EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKN
Ga0244775_1041216413300024346EstuarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFK
Ga0209716_114762613300025626Pelagic MarineMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0209715_113969223300025699Pelagic MarineMIEDQRSELKQAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPRN
Ga0208917_112129523300025840AqueousMALNNMELYSDEIKFNLFHDKKRKDLKMLTVLNDFVKPSTHFVYYMFKDSIHVDDYGSIKETLFKFPSMIKNSSN
Ga0208783_1032190423300025872AqueousNIFYEKKRREIRNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSPC
Ga0209631_1010982723300025890Pelagic MarineMELYQDEVRFNLFHEKKRKDLKILAALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0208916_1014145913300025896AqueousVNFNLFYDKKRREIKNLLSLNDFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPTLNKVRII
Ga0209425_1043405523300025897Pelagic MarineLKAAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRG
Ga0207708_1190072613300026075Corn, Switchgrass And Miscanthus RhizosphereNRQELTQSLHCMDIYTDDMTFNTFHEKKKKDLKVLNVLNDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSMIRVSKQ
Ga0208174_103153313300027243EstuarineMELYASENNFNIFYEKKRRELKNLQLLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFP
Ga0209598_1033764923300027760Freshwater LakeMTFSTFFERKKKDLKVLQVLNDFVKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPSLTKNQSQ
Ga0209175_1019558413300027781Wastewater EffluentTYYEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFP
Ga0209174_1016726013300027789Wastewater EffluentMTFNTYYEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFPQMTRV
Ga0209229_1010536213300027805Freshwater And SedimentMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSLTHSNPL
Ga0209229_1036654013300027805Freshwater And SedimentMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVSTTHPNFL
Ga0209092_1027322323300027833MarineMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKSS
Ga0209450_1120210713300027885Freshwater Lake SedimentEKKRRDIVALQTLNEFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPTLTKVCYHLS
Ga0209668_1045359833300027899Freshwater Lake SedimentMELYSNENNFNIFYEKKRKELKNLQTLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPTLNKVS
Ga0209400_115623313300027963Freshwater LakeMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFK
(restricted) Ga0255057_1014543933300027997SeawaterMIEDQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0307400_1013127223300030709MarineMIEDQRSELKQAVNKMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKS
Ga0074000_1005251723300030860SoilVNRAELNNALTKMDIYTDDMAFNSFYDQKKKDIKMLSVLTDFVKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSMTKSANN
Ga0073977_163039223300030948MarineYEVNFNLFYDKKCREIKQLQALNDFVKPNPYFLYYMFKDTIHVDDYGSIKETLFKFPSLN
Ga0073978_158397723300031036MarineMELYSNENNFNIFYDSKRRDLKNLQMLNDFVKPNQYFSYFMFKDSIHVDDYGSIKETLFKFPSMNRNSN
Ga0308147_103919213300031558MarineQDEVRFNLFHENKRKNLKILHALTEFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKN
Ga0307993_106184123300031602MarineMIEEQRNELKSAVNRMELYQDEVRFNLFHENKRKNLKILHALTEFIKPNPYFVYYMFKDTIHVDDYGSIKETLF
Ga0302125_1004345923300031638MarineMELYASENNFNIFYEKKRRELRNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRVSAIISLFTNNNVVASF
Ga0307386_1031742513300031710MarineNELKQAINKIELYQDEVHFNLFHEKKRKDLKILHAITDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0311351_1108482123300031722FenMEYYSDDMTFNTYFEKKKRDLKVLSVLNDFIKPNPYFVYYMFKDSIHVDDYGSIKETLFKFP
Ga0307391_1045394423300031729MarineELYASENNFNIFYEKKRRELKNLQQLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGAQN
Ga0307394_1040973723300031735MarineMELYSSDITFNIFYEKKRKELQELGRLNTFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNANNSARIFLFGDDVN
Ga0307387_1015051013300031737MarineLTTQVKNMELYASENNFNIFYEKKRRELKNLQQLNEFVKPAPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGAQN
Ga0307387_1057244013300031737MarineMELYQDENRFNIFHEKKRKDLKILSALNDFINPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKS
Ga0307395_1048304723300031742MarineQDLITQFKNMDIYTSDINFNIFYEKKCKDLKNLHNLNEFVQPNPYFVYYMFKDTIHVDDYGSIKETLFKFPTLTKSNANNSARIFLFGDDVN
Ga0315906_1041697523300032050FreshwaterEQRTELKAAVNKMELYQDENKFNLFHEKKRKDLKMLSALNEFIKPSQYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPKS
Ga0314684_1047065623300032463SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRGQANIYLFGDD
Ga0314670_1056881823300032470SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKF
Ga0314668_1060261823300032481SeawaterMIDEQRNDLKSSINKMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0314676_1034863013300032519SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRGQANIYLFGD
Ga0314667_1003099533300032520SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRG
Ga0314677_1012419513300032522SeawaterQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0314673_1014472923300032650SeawaterDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRG
Ga0314703_1021735123300032723SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNR
Ga0314696_1067653313300032728SeawaterEKMIDEQRNDLKSSINKMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0314711_1037892113300032732SeawaterMIEEQRNELKSAVNKMELYQDEVRFNLFHEKKRKDLKILSALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGSRGQANIYLFG
Ga0314710_1039637813300032742SeawaterINKMELYQDEVRFNLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0314710_1041877313300032742SeawaterMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRGPKSQANIYLFGDDINSK
Ga0314712_1011916113300032747SeawaterLFHEKKRKDLKILQALNDFIKPNPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNKGPRN
Ga0310342_10299148433300032820SeawaterMELYQDENRFNIFHEKKRKDLKILSALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSLNRG
Ga0335024_0313375_516_8003300034051FreshwaterMIEDQRTELKQAVSKMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNRGPKNQANIYLFGDD
Ga0335014_0164137_2_2683300034094FreshwaterMIEDQRTELKQAVSKMELYQDENRFNLFHEKKRKDLKILQALNDFIKPSPYFVYYMFKDTIHVDDYGSIKETLFKFPSMNRGPKNQANI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.