NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096680

Metagenome / Metatranscriptome Family F096680

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096680
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 38 residues
Representative Sequence METILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA
Number of Associated Samples 79
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.42 %
% of genes near scaffold ends (potentially truncated) 13.46 %
% of genes from short scaffolds (< 2000 bps) 74.04 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.692 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.654 % of family members)
Environment Ontology (ENVO) Unclassified
(19.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(36.538 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.62%    β-sheet: 0.00%    Coil/Unstructured: 52.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02811PHP 49.04
PF01975SurE 6.73
PF05235CHAD 4.81
PF02518HATPase_c 2.88
PF13263PHP_C 1.92
PF00005ABC_tran 1.92
PF01895PhoU 1.92
PF00300His_Phos_1 1.92
PF13432TPR_16 0.96
PF13489Methyltransf_23 0.96
PF00486Trans_reg_C 0.96
PF13177DNA_pol3_delta2 0.96
PF12706Lactamase_B_2 0.96
PF00528BPD_transp_1 0.96
PF01695IstB_IS21 0.96
PF12849PBP_like_2 0.96
PF01022HTH_5 0.96
PF00834Ribul_P_3_epim 0.96
PF13531SBP_bac_11 0.96
PF13340DUF4096 0.96
PF13188PAS_8 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 6.73
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 4.81
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 4.81
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.96
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.69 %
UnclassifiedrootN/A17.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090005|LWSO_GFMCQXZ02GHVT9Not Available523Open in IMG/M
3300000228|TB_PC08_66DRAFT_10029738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2267Open in IMG/M
3300000228|TB_PC08_66DRAFT_10039308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1871Open in IMG/M
3300000230|TB_GS10_10DRAFT_10004301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila8601Open in IMG/M
3300000230|TB_GS10_10DRAFT_10097412Not Available1137Open in IMG/M
3300000233|TB_FS06_10DRAFT_1017362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2435Open in IMG/M
3300001213|JGIcombinedJ13530_104677742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi522Open in IMG/M
3300001213|JGIcombinedJ13530_109639284Not Available521Open in IMG/M
3300001765|MIS_1000127All Organisms → cellular organisms → Bacteria42586Open in IMG/M
3300002024|MIS_1141224Not Available1050Open in IMG/M
3300002026|MIS_10002140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila21461Open in IMG/M
3300002026|MIS_10026601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila5862Open in IMG/M
3300002027|MIS_10041164All Organisms → cellular organisms → Bacteria2940Open in IMG/M
3300002027|MIS_10057424All Organisms → cellular organisms → Bacteria2608Open in IMG/M
3300002027|MIS_10109867All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300003432|JGI20214J51088_10527965All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300003541|JGI20214J51650_10408365All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300004282|Ga0066599_100614691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi731Open in IMG/M
3300004780|Ga0062378_10120755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi667Open in IMG/M
3300005077|Ga0071116_1010363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila8123Open in IMG/M
3300005659|Ga0073900_10198153All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300005829|Ga0074479_10319474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi988Open in IMG/M
3300005829|Ga0074479_10740509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi557Open in IMG/M
3300005831|Ga0074471_10851558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales3682Open in IMG/M
3300005831|Ga0074471_11052952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1112Open in IMG/M
3300005905|Ga0075269_10100486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi550Open in IMG/M
3300005982|Ga0075156_10045393All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300006092|Ga0082021_1016645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales7077Open in IMG/M
3300007521|Ga0105044_10193690All Organisms → cellular organisms → Bacteria2070Open in IMG/M
3300009009|Ga0105105_10080710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1533Open in IMG/M
3300009009|Ga0105105_10462503Not Available719Open in IMG/M
3300009009|Ga0105105_10557893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium663Open in IMG/M
3300009009|Ga0105105_10641651Not Available625Open in IMG/M
3300009009|Ga0105105_10849410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi555Open in IMG/M
3300009032|Ga0105048_10005564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi20341Open in IMG/M
3300009081|Ga0105098_10542574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi598Open in IMG/M
3300009083|Ga0105047_10000766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi55846Open in IMG/M
3300009091|Ga0102851_11793465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium691Open in IMG/M
3300009131|Ga0115027_10607956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila806Open in IMG/M
3300009131|Ga0115027_11456990Not Available560Open in IMG/M
3300009131|Ga0115027_11488211Not Available555Open in IMG/M
3300009131|Ga0115027_11767381Not Available517Open in IMG/M
3300009146|Ga0105091_10132185All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300009179|Ga0115028_10368381All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300010293|Ga0116204_1270226Not Available534Open in IMG/M
3300011428|Ga0137456_1151975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi621Open in IMG/M
3300012018|Ga0119867_1153030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi614Open in IMG/M
3300012146|Ga0137322_1029818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi780Open in IMG/M
3300012166|Ga0137350_1120270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi532Open in IMG/M
3300012956|Ga0154020_10184635All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300012956|Ga0154020_10452223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1087Open in IMG/M
(restricted) 3300013123|Ga0172368_10105100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila1633Open in IMG/M
(restricted) 3300013123|Ga0172368_10264804All Organisms → cellular organisms → Bacteria834Open in IMG/M
(restricted) 3300013125|Ga0172369_10316258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi819Open in IMG/M
(restricted) 3300013126|Ga0172367_10000302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi75267Open in IMG/M
(restricted) 3300013131|Ga0172373_10117277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1966Open in IMG/M
3300014303|Ga0075358_1020560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi942Open in IMG/M
3300014303|Ga0075358_1060883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi664Open in IMG/M
3300015251|Ga0180070_1040341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi620Open in IMG/M
3300018084|Ga0184629_10243079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae939Open in IMG/M
3300020048|Ga0207193_1002084All Organisms → cellular organisms → Bacteria35219Open in IMG/M
3300020048|Ga0207193_1028242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6609Open in IMG/M
3300020213|Ga0163152_10075005All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300021063|Ga0206227_1130409Not Available509Open in IMG/M
3300021090|Ga0210377_10487395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium714Open in IMG/M
3300021333|Ga0210324_1272325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi863Open in IMG/M
(restricted) 3300023208|Ga0233424_10026251All Organisms → cellular organisms → Bacteria2875Open in IMG/M
(restricted) 3300024054|Ga0233425_10007337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi15579Open in IMG/M
3300025115|Ga0209835_1163890Not Available534Open in IMG/M
3300027739|Ga0209575_10125736Not Available928Open in IMG/M
3300027762|Ga0209288_10107503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae878Open in IMG/M
3300027762|Ga0209288_10228741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi611Open in IMG/M
3300027776|Ga0209277_10127945Not Available1108Open in IMG/M
3300027878|Ga0209181_10000374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae84583Open in IMG/M
3300027887|Ga0208980_10086213All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300027890|Ga0209496_10187287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi975Open in IMG/M
3300027899|Ga0209668_10665073Not Available698Open in IMG/M
3300028283|Ga0268283_1090354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi896Open in IMG/M
3300028646|Ga0302159_10068376Not Available787Open in IMG/M
3300028649|Ga0302162_10125851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi609Open in IMG/M
3300028676|Ga0302167_10046286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1317Open in IMG/M
3300028804|Ga0268298_10000940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae36144Open in IMG/M
3300028804|Ga0268298_10019987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae5081Open in IMG/M
3300028804|Ga0268298_10313478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi809Open in IMG/M
3300029981|Ga0302293_10046508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae1531Open in IMG/M
3300030055|Ga0302173_10324472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi589Open in IMG/M
3300030492|Ga0302212_1085009Not Available854Open in IMG/M
3300030943|Ga0311366_10070987All Organisms → cellular organisms → Bacteria2991Open in IMG/M
3300031521|Ga0311364_12409789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi513Open in IMG/M
3300031902|Ga0302322_101957749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi719Open in IMG/M
3300032420|Ga0335397_10000442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi53364Open in IMG/M
3300033418|Ga0316625_100746691All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300033433|Ga0326726_11093506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi775Open in IMG/M
3300033482|Ga0316627_101351069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi713Open in IMG/M
3300033482|Ga0316627_102328957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi562Open in IMG/M
3300033521|Ga0316616_100219588All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300033521|Ga0316616_102061456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi757Open in IMG/M
3300033557|Ga0316617_100014030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica3876Open in IMG/M
3300033557|Ga0316617_100949639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi837Open in IMG/M
3300034101|Ga0335027_0554337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium709Open in IMG/M
3300034155|Ga0370498_042978Not Available993Open in IMG/M
3300034156|Ga0370502_0028104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae1758Open in IMG/M
3300034158|Ga0370507_0108154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi870Open in IMG/M
3300034196|Ga0370503_0256197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi633Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment8.65%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.69%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater6.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.73%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland5.77%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater4.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater4.81%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland4.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.85%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)3.85%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil3.85%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge2.88%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water1.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge1.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.96%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.96%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
SinkholeEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole0.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.96%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.96%
Wastewater Treatment PlantEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090005Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1EnvironmentalOpen in IMG/M
3300000228Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66EnvironmentalOpen in IMG/M
3300000230Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10EnvironmentalOpen in IMG/M
3300000233Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001765Sinkhole freshwater microbial communities from Lake Huron, USA - combined 2007-2012EnvironmentalOpen in IMG/M
3300002024Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5kEnvironmentalOpen in IMG/M
3300002026Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+EnvironmentalOpen in IMG/M
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005077Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014EnvironmentalOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300006092Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, SingaporeEngineeredOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300012018Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)EngineeredOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013125 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25mEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300014303Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020213Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300025115Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027878Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028283Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36mEnvironmentalOpen in IMG/M
3300028646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2EnvironmentalOpen in IMG/M
3300028649Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2EnvironmentalOpen in IMG/M
3300028676Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1EnvironmentalOpen in IMG/M
3300028804Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP WeurtEngineeredOpen in IMG/M
3300029981Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2EnvironmentalOpen in IMG/M
3300030055Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_1EnvironmentalOpen in IMG/M
3300030492Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_2EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034156Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18EnvironmentalOpen in IMG/M
3300034158Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18EnvironmentalOpen in IMG/M
3300034196Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LWSO_011692402088090005Freshwater SedimentMETILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA
TB_PC08_66DRAFT_1002973813300000228GroundwaterMERIMQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA*
TB_PC08_66DRAFT_1003930833300000228GroundwaterMETIFPSVLFLSMIIVFSVDATRKRREFLKKHNRA*
TB_GS10_10DRAFT_1000430163300000230GroundwaterMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRI*
TB_GS10_10DRAFT_1009741213300000230GroundwaterMETILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA*
TB_FS06_10DRAFT_101736233300000233GroundwaterMQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA*
JGIcombinedJ13530_10467774223300001213WetlandMETIIPSVIFVSLIVVFGVDARQKRRDFLRKQKQA*
JGIcombinedJ13530_10963928413300001213WetlandMETILPSVIFVSMVVIFGVDATRKRRAFLKKHKRA*
MIS_1000127143300001765Sinkhole FreshwaterMQTILPSVIFLSMVIIFGVDATRKRRAFLKKHNHN*
MIS_114122423300002024Sinkhole FreshwaterMELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA*
MIS_10002140173300002026Sinkhole FreshwaterMETILPSVIFLSMVVVFGVDATRKRREFLKKHDRA*
MIS_1002660133300002026Sinkhole FreshwaterMETILPSVIFLSMVVVFGVDATRKRRDFLKKRNRI*
MIS_1004116453300002027Sinkhole FreshwaterMETILPSVIFLSMVVVFGVDASRKRREFLKKRNRI*
MIS_1005742433300002027Sinkhole FreshwaterMGTILPSVIFLSMIVVFSVDAAQKRRAYLKKRKLT*
MIS_1010986733300002027Sinkhole FreshwaterMETIFPAFIFVSIVVVFSVDANRKRREFLKKYRSE*
JGI20214J51088_1052796523300003432WetlandMESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV*
JGI20214J51650_1040836523300003541WetlandVYHFSIQMESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV*
Ga0066599_10061469113300004282FreshwaterMESIMETILPSVIFLSMVVVFGVDATRKRREFLKKHNRA*
Ga0062378_1012075523300004780Wetland SedimentMYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA*
Ga0071116_101036343300005077SinkholeMELSMETILQSVVFVSMIIVFGVDATRKRREFLRKHKRA*
Ga0073900_1019815323300005659Activated SludgeMETILPSVIFLSMVVVFSVDATRKRREFLKKHKSA*
Ga0074479_1031947433300005829Sediment (Intertidal)METILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA*
Ga0074479_1074050913300005829Sediment (Intertidal)RNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKNA*
Ga0074471_1085155833300005831Sediment (Intertidal)MGALVPSVIFLSMVIIFGVDAKRKRRDFLKKQKQA*
Ga0074471_1105295223300005831Sediment (Intertidal)MQTILPSVIFLSMVVIFGVDASRKRRDFLKKRNRT*
Ga0075269_1010048613300005905Rice Paddy SoilETILPSVIFVSMVIVFGVDATRKRRDFLKKHKRA*
Ga0075156_1004539333300005982Wastewater EffluentMETILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA*
Ga0082021_101664553300006092Wastewater Treatment PlantMETILSSVIFVSMVLVFGVDATRKRRDYLKKRSRN*
Ga0105044_1019369023300007521FreshwaterMETILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA*
Ga0105105_1008071013300009009Freshwater SedimentMESIMQTILPSVIFLSMVIVFGVDATLKRREFLKKNNRV*
Ga0105105_1046250313300009009Freshwater SedimentMENFMETILPSVIFLSMIVVFGVDATRKRREFLKKNNRA*
Ga0105105_1055789323300009009Freshwater SedimentMELVMETIVQSVIFISMIVIFGVDASRKRREFLKKQNRS*
Ga0105105_1064165123300009009Freshwater SedimentMESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRT*
Ga0105105_1084941013300009009Freshwater SedimentMEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA*
Ga0105048_10005564103300009032FreshwaterMYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS*
Ga0105098_1054257423300009081Freshwater SedimentMGTYQMEIIMQTILPSVIFLSMIVVFGVDASRKRRDFLRKQKRA*
Ga0105047_10000766323300009083FreshwaterMETILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA*
Ga0102851_1179346513300009091Freshwater WetlandsMETILPSVIFVSMMIVFGVDATRKRRDFLKKRNRA*
Ga0115027_1060795623300009131WetlandMETILPSVIFVSMIVIFGVDASRKRRDFLKKRKRA*
Ga0115027_1145699013300009131WetlandMETILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA*
Ga0115027_1148821123300009131WetlandMEINMETIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA*
Ga0115027_1176738113300009131WetlandMERFMETLLPSVIFLSMVIVFGVDASRKRREFLKKQNQT*
Ga0105091_1013218523300009146Freshwater SedimentMENIMETILPSVIFLSMVVIFGVDATRKRREFLKKRNRA*
Ga0115028_1036838123300009179WetlandMESIMQTILPSVIFLSMVIVFGVDASRKRRDFLKKNNRV*
Ga0116204_127022613300010293Anoxic Lake WaterMEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA*
Ga0137456_115197513300011428SoilCRNGEYMETILPSVIFVSMIVIFGVDAARKRRDFLKKHKRA*
Ga0119867_115303023300012018Activated SludgeMETIFPSFLILSMVVVFSVDATRKRREFLNKRKTA*
Ga0137322_102981823300012146SoilMETILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA*
Ga0137350_112027013300012166SoilLKSKINTLMYHGYIEMESVMETILPSVIFVSIIVVFGVDATRKRRDFLKKHKRA*
Ga0154020_1018463523300012956Active SludgeMETILPSVIFLSMVVVISVDATRKRREFLKKHKSA*
Ga0154020_1045222333300012956Active SludgeYMETILPSVIFLSMVVVFSVDATRKRREFLKKHKSA*
(restricted) Ga0172368_1010510023300013123FreshwaterMETILPSVIFLSMIIVFSVDASRKRREFLKKHKRA*
(restricted) Ga0172368_1026480423300013123FreshwaterMETILPSVIFLSMIIVFGVDGTRKRREYLKKQKRS*
(restricted) Ga0172369_1031625823300013125FreshwaterETILPSVIFLSMIIVFSVDASRKRREFLKKHKRA*
(restricted) Ga0172367_10000302663300013126FreshwaterMGIQMEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA*
(restricted) Ga0172373_1011727743300013131FreshwaterMETLLSPFLFLSMIVVFSVDAQRKRREFLKKHTTA*
Ga0075358_102056013300014303Natural And Restored WetlandsMAMEINMETIFQSVIFLSMIVVFGVDATRKRREFLRKQKRA*
Ga0075358_106088313300014303Natural And Restored WetlandsRNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA*
Ga0180070_104034123300015251SoilMETILPSVIFVSMVVVFGVDAARKRRDFLKKRDRA*
Ga0184629_1024307923300018084Groundwater SedimentMETIFTSIIFVSMVVVFGVDATRKRRDFLKKNKSA
Ga0207193_1002084163300020048Freshwater Lake SedimentMETILPSVIFLSMVVVFGVDATRKRREFLKKHDRA
Ga0207193_102824263300020048Freshwater Lake SedimentMETILPSVIFLSMVVVFGVDASRKRREFLKKRNRI
Ga0163152_1007500533300020213Freshwater Microbial MatMETILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA
Ga0206227_113040913300021063Deep Subsurface SedimentMETILPSVIFVSMVVVFGVDAARKRRDFLKKRNRA
Ga0210377_1048739523300021090Groundwater SedimentMETILPSVIFLSMIVVFGVDATRKRRDFLKKHKRA
Ga0210324_127232523300021333EstuarineMETILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA
(restricted) Ga0233424_1002625133300023208FreshwaterMESIFPSVIFLSMIIIFSVDAKRKRRDFLKKNKRA
(restricted) Ga0233425_10007337163300024054FreshwaterMRIYPLEINMETILQSVVFVSMVIVFGVDATRKRREFLRKQKRA
Ga0209835_116389023300025115Anoxic Lake WaterMEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA
Ga0209575_1012573623300027739FreshwaterMELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA
Ga0209288_1010750323300027762Freshwater SedimentMETILPSVIFLSMIVVFGVDATRKRREFLKKNNRA
Ga0209288_1022874123300027762Freshwater SedimentMESFMETILPSVIFLSMVVVFGVDASRKRREFLKKRNRI
Ga0209277_1012794523300027776Wastewater EffluentMETILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA
Ga0209181_10000374253300027878FreshwaterMYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS
Ga0208980_1008621333300027887WetlandMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA
Ga0209496_1018728733300027890WetlandMYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA
Ga0209668_1066507323300027899Freshwater Lake SedimentMYHIEHRNGERMETILPSVIFVSIIVIFGVDATRKRRDFLKKQKRA
Ga0268283_109035423300028283Saline WaterMETIIPSVIFLSMVVVFGVDANRKRRDFLKKHKRA
Ga0302159_1006837613300028646FenMETILPSIIFASIIVVFGVDATRKRRDFLKKHKRF
Ga0302162_1012585123300028649FenMETILPSVIFVSMVIVFGFDATRKRRDYLKKDKRA
Ga0302167_1004628623300028676FenMETILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA
Ga0268298_10000940193300028804Activated SludgeMETIFPSFLFLSMVVVFSVDATRKRREFLKKRKTA
Ga0268298_1001998733300028804Activated SludgeMETLLSPFLFLSMIVVFSVDAKRKRREFLKKHTPA
Ga0268298_1031347813300028804Activated SludgeMETILPSVIFLSMVFVIGVDAARKRRDFLKKNKHAS
Ga0302293_1004650823300029981FenMETILPSVIFVSMIVVFGVDATRKRRDFLKKNKSA
Ga0302173_1032447213300030055FenVSWHCRNGEHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA
Ga0302212_108500923300030492FenMETILPSVIFVSMIVVFGVDATRKRRDFLKKNKRA
Ga0311366_1007098713300030943FenMETILPSVIFVSMVIVFGFDATRKRREFLKKHKRA
Ga0311364_1240978923300031521FenEHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA
Ga0302322_10195774923300031902FenCMETILPSIIFASIIVVFGVDATRKRRDFLKKHKRF
Ga0335397_10000442413300032420FreshwaterMETILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA
Ga0316625_10074669123300033418SoilMESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRV
Ga0326726_1109350623300033433Peat SoilSEVSSHYRNGERMETILPSVIFVSMVVIFGVDAARKRRDFLKKNKRA
Ga0316627_10135106923300033482SoilVRIQMEIIMETILQSVVFVSMIIVFGVDATRKRRDFLRKQKRA
Ga0316627_10232895723300033482SoilKHRNGERMETILTSVIFVSIVVVFGVDATRKRRDFLKKHKRA
Ga0316616_10021958833300033521SoilMRIYQMEIIMETFFQSVVFVSMIIVFGVDATRKRRDFLRKQKRS
Ga0316616_10206145623300033521SoilMETILPSMIFVSMIVIFGVDASRKRRDFLKKHKRA
Ga0316617_10001403053300033557SoilMETILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA
Ga0316617_10094963923300033557SoilMETIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA
Ga0335027_0554337_169_2763300034101FreshwaterMETILPSVIFLSMIIVFSLDATRKRREFLKNQKPT
Ga0370498_042978_872_9913300034155Untreated Peat SoilMESFMETILPSVIFLSMVVVFGVDATRKRRAFLKKRSRI
Ga0370502_0028104_1424_15313300034156Untreated Peat SoilMETILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA
Ga0370507_0108154_51_1703300034158Untreated Peat SoilMESFMETILPSVIFLSMVVIFGVDATRKRRAFLKKRSRI
Ga0370503_0256197_2_1273300034196Untreated Peat SoilYRNGEYMETILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.