NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094045

Metagenome Family F094045

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094045
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 52 residues
Representative Sequence MKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK
Number of Associated Samples 87
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 20.75 %
% of genes near scaffold ends (potentially truncated) 20.75 %
% of genes from short scaffolds (< 2000 bps) 65.09 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.906 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere
(6.604 % of family members)
Environment Ontology (ENVO) Unclassified
(47.170 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.057 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.25%    β-sheet: 0.00%    Coil/Unstructured: 43.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03109ABC1 44.34
PF13277YmdB 3.77
PF00702Hydrolase 1.89
PF01148CTP_transf_1 1.89
PF09603Fib_succ_major 0.94
PF02325YGGT 0.94
PF01966HD 0.94
PF01988VIT1 0.94
PF02416TatA_B_E 0.94
PF13231PMT_2 0.94
PF10431ClpB_D2-small 0.94
PF05157T2SSE_N 0.94
PF00293NUDIX 0.94
PF07963N_methyl 0.94
PF01168Ala_racemase_N 0.94
PF01566Nramp 0.94
PF11611DUF4352 0.94
PF00300His_Phos_1 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 44.34
COG0762Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT familyPosttranslational modification, protein turnover, chaperones [O] 0.94
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.94
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.94
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.94
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.91 %
UnclassifiedrootN/A15.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000476|ZC3D78_109264All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium813Open in IMG/M
3300001213|JGIcombinedJ13530_109826053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1113Open in IMG/M
3300001408|JGI20206J14855_1021043Not Available1050Open in IMG/M
3300001979|JGI24740J21852_10036735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1518Open in IMG/M
3300002184|JGI24770J26754_10128515All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium910Open in IMG/M
3300003320|rootH2_10000311All Organisms → cellular organisms → Bacteria277677Open in IMG/M
3300003320|rootH2_10265406All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1426Open in IMG/M
3300004463|Ga0063356_100608802All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1478Open in IMG/M
3300005327|Ga0070658_10203314All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300005327|Ga0070658_11440358All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium598Open in IMG/M
3300005334|Ga0068869_100030117All Organisms → cellular organisms → Bacteria3807Open in IMG/M
3300005347|Ga0070668_100118546All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2113Open in IMG/M
3300005347|Ga0070668_100173586All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1756Open in IMG/M
3300005347|Ga0070668_101107332All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium715Open in IMG/M
3300005365|Ga0070688_101142706All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium624Open in IMG/M
3300005455|Ga0070663_100291271All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1304Open in IMG/M
3300005455|Ga0070663_101136912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium684Open in IMG/M
3300005530|Ga0070679_100904725All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium826Open in IMG/M
3300005534|Ga0070735_10924583Not Available512Open in IMG/M
3300005539|Ga0068853_100077647All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2901Open in IMG/M
3300005563|Ga0068855_100022217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium7603Open in IMG/M
3300005841|Ga0068863_102100443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium575Open in IMG/M
3300005842|Ga0068858_100110549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2566Open in IMG/M
3300005842|Ga0068858_100176218All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2018Open in IMG/M
3300005844|Ga0068862_100117843All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2337Open in IMG/M
3300006048|Ga0075363_100154925All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1295Open in IMG/M
3300006237|Ga0097621_100000322All Organisms → cellular organisms → Bacteria32440Open in IMG/M
3300006627|Ga0101571_10896702All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium994Open in IMG/M
3300006801|Ga0079223_10929859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium549Open in IMG/M
3300006865|Ga0073934_10055342All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium3384Open in IMG/M
3300009032|Ga0105048_11056183Not Available684Open in IMG/M
3300009084|Ga0105046_10719582All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium883Open in IMG/M
3300009093|Ga0105240_10193503All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium CG_4_10_14_0_2_um_filter_52_92390Open in IMG/M
3300009095|Ga0079224_101381176All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1001Open in IMG/M
3300009095|Ga0079224_102895181All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium685Open in IMG/M
3300009095|Ga0079224_103891178All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium591Open in IMG/M
3300009098|Ga0105245_10565483All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1160Open in IMG/M
3300009098|Ga0105245_10792157All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium985Open in IMG/M
3300009160|Ga0114981_10581427Not Available596Open in IMG/M
3300009448|Ga0114940_10134599All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1100Open in IMG/M
3300009553|Ga0105249_13020061All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium540Open in IMG/M
3300009685|Ga0116142_10055245All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2293Open in IMG/M
3300010223|Ga0136270_1000223All Organisms → cellular organisms → Bacteria23862Open in IMG/M
3300010396|Ga0134126_10313173All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1838Open in IMG/M
3300011187|Ga0136596_1012360All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2311Open in IMG/M
3300011187|Ga0136596_1086722All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium619Open in IMG/M
3300012930|Ga0137407_11293328All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium693Open in IMG/M
3300012942|Ga0164242_10015306All Organisms → cellular organisms → Bacteria8031Open in IMG/M
3300013105|Ga0157369_11056011Not Available831Open in IMG/M
3300013296|Ga0157374_10000709All Organisms → cellular organisms → Bacteria29221Open in IMG/M
3300013296|Ga0157374_10056251All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium3672Open in IMG/M
3300013296|Ga0157374_11006990Not Available852Open in IMG/M
3300013297|Ga0157378_10088587All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2809Open in IMG/M
3300013297|Ga0157378_12913684Not Available531Open in IMG/M
3300014159|Ga0181530_10106307All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1668Open in IMG/M
3300014165|Ga0181523_10509095All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium665Open in IMG/M
3300014200|Ga0181526_10606789All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium691Open in IMG/M
3300014208|Ga0172379_10087621All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2466Open in IMG/M
3300014325|Ga0163163_10029677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium5263Open in IMG/M
3300014325|Ga0163163_10092987All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria3032Open in IMG/M
3300014745|Ga0157377_10082259All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1885Open in IMG/M
3300014968|Ga0157379_12555010Not Available511Open in IMG/M
3300015084|Ga0167654_1047501Not Available593Open in IMG/M
3300017948|Ga0187847_10020246All Organisms → cellular organisms → Bacteria4120Open in IMG/M
3300020034|Ga0193753_10051886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2194Open in IMG/M
3300020034|Ga0193753_10186926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium959Open in IMG/M
3300020583|Ga0210401_11602552Not Available508Open in IMG/M
3300021181|Ga0210388_11141687All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium663Open in IMG/M
(restricted) 3300021518|Ga0224722_1001310All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria13839Open in IMG/M
3300022751|Ga0247817_10283779Not Available555Open in IMG/M
3300023090|Ga0224558_1004785All Organisms → cellular organisms → Bacteria10315Open in IMG/M
3300023095|Ga0247736_10077075Not Available1147Open in IMG/M
3300025310|Ga0209172_10073265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2037Open in IMG/M
3300025323|Ga0209542_10279480All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1439Open in IMG/M
3300025721|Ga0209587_1198838Not Available527Open in IMG/M
3300025859|Ga0209096_1106879All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1143Open in IMG/M
3300025861|Ga0209605_1087005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1289Open in IMG/M
3300025913|Ga0207695_10242184All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1704Open in IMG/M
3300025921|Ga0207652_11017335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium728Open in IMG/M
3300025927|Ga0207687_10000008All Organisms → cellular organisms → Bacteria497738Open in IMG/M
3300025927|Ga0207687_10973753All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium727Open in IMG/M
3300025927|Ga0207687_11188487Not Available655Open in IMG/M
3300025942|Ga0207689_10898754All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium747Open in IMG/M
3300025949|Ga0207667_11750302Not Available587Open in IMG/M
3300025960|Ga0207651_12099699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium507Open in IMG/M
3300025972|Ga0207668_10105389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2104Open in IMG/M
3300025972|Ga0207668_10158617All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1760Open in IMG/M
3300025986|Ga0207658_10127591All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2038Open in IMG/M
3300026035|Ga0207703_10089946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2579Open in IMG/M
3300026041|Ga0207639_10055054All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium3043Open in IMG/M
3300026078|Ga0207702_12075626All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium558Open in IMG/M
(restricted) 3300027728|Ga0247836_1203698All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium786Open in IMG/M
3300027857|Ga0209166_10049367All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria2465Open in IMG/M
3300027870|Ga0209023_10001379All Organisms → cellular organisms → Bacteria32718Open in IMG/M
3300028374|Ga0306906_1031672All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium903Open in IMG/M
3300028380|Ga0268265_10086346All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium2493Open in IMG/M
(restricted) 3300028557|Ga0247832_1123335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1049Open in IMG/M
(restricted) 3300028571|Ga0247844_1001224All Organisms → cellular organisms → Bacteria49090Open in IMG/M
3300028800|Ga0265338_10001602All Organisms → cellular organisms → Bacteria36326Open in IMG/M
3300028800|Ga0265338_10140874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1889Open in IMG/M
3300029951|Ga0311371_11138323All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium910Open in IMG/M
3300031250|Ga0265331_10170277All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium986Open in IMG/M
3300031525|Ga0302326_10825140All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium1332Open in IMG/M
3300032456|Ga0335394_10710295All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium749Open in IMG/M
3300032895|Ga0335074_11469444Not Available545Open in IMG/M
3300032898|Ga0335072_10080841All Organisms → cellular organisms → Bacteria4224Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil3.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.83%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.83%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge2.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.89%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.89%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.94%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.94%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.94%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.94%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
CompostEngineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000476ZC3D78EngineeredOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001408Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012EnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002184Freshwater and sediment microbial communities from Lake Erie, CanadaEnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006627Soil microbial communities from the Leymus chinensis steppe, China - after adding 28 g N m- 2, yr-1EnvironmentalOpen in IMG/M
3300006801Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011EnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009448Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek SourceEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009685Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaGEngineeredOpen in IMG/M
3300010223Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 3EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011187Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012942Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014208Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021518 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaGEnvironmentalOpen in IMG/M
3300022751Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L212-509R-1EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023095Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L193-509B-2EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025323Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025721Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes)EnvironmentalOpen in IMG/M
3300025859Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025861Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300028374Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300032456Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ZC3D78_10926423300000476CompostMKYLSIFFTILFVWVAVLLMALTRDNTTEIFQLYLAVMVSTVVLFLIGFAKK*
JGIcombinedJ13530_10982605323300001213WetlandMKYISIFFTILFIWLAVILMAFARTHTGEIFKLYLAVMISTLVLFLIGFAKK*
JGI20206J14855_102104333300001408Arctic Peat SoilMKYASTFFTILLIWIAVILMSLSVHNSGQVFELFLAVMVSTLVLFLIGFGRS*
JGI24740J21852_1003673543300001979Corn RhizosphereMKYASIFATILFIWIAVIIMALTTTNANQIYGLYLAGIISTLALFVIGFARK*
JGI24770J26754_1012851523300002184Freshwater And SedimentMKYISIFFTILLIWIAIVLMAFTRSSATEVFELFLAAIASTVILFLIGFKRK*
rootH2_10000311353300003320Sugarcane Root And Bulk SoilMKYASVFVTIVLIWIAIILMALTRKSPNDVFELYVSAIVATLALFMIGFRKR*
rootH2_1026540623300003320Sugarcane Root And Bulk SoilMKYASIFVTIVLIWVAVILMAVTRRDPTDIFELYVSGIVSTLVLFLIGFSKR*
Ga0063356_10060880223300004463Arabidopsis Thaliana RhizosphereMKYISAFITILIIWIAAILIALAHSEASEIFALYLVVMISTLALFLIGFSKK*
Ga0070658_1020331423300005327Corn RhizosphereMKYVSVFATIVLIWIAVILMAATRSVPSEIFKLYVAAIISTLALFVIGFTRG*
Ga0070658_1144035823300005327Corn RhizosphereMKYASVFVTIVLIWIAVILMAATRSAPDEIFKLYIAAIISTLALFVIGFARK*
Ga0068869_10003011763300005334Miscanthus RhizosphereMKYASIFATIVLIWLAVVLMATTRGDAKEVFELYVTAIISTLVLFVIGFGKR*
Ga0070668_10011854643300005347Switchgrass RhizosphereMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK*
Ga0070668_10017358613300005347Switchgrass RhizosphereMKYISIFFTILFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK*
Ga0070668_10110733223300005347Switchgrass RhizosphereMKYVSIFFTILFIWIAVIFMAFSRSNTNEIFELYLAVMGSTVVLFLIGFGRK*
Ga0070688_10114270623300005365Switchgrass RhizosphereMKYASIFFTILIIWIATILMALTREDPNEIFELYLAVTICTLALFLIGFAKK*
Ga0070663_10029127123300005455Corn RhizosphereMKYASIFATILLIWLAVILMAITRKDPTDIFELYVAAIISTAALFLIGFSKK*
Ga0070663_10113691223300005455Corn RhizosphereMKYLSIFATILLIWVAVILMALTSNSSQQIYELYLAVIVSTVALFLIGFARK*
Ga0070679_10090472523300005530Corn RhizosphereMKYASIFLTIVFIWIAVIIMAFTRSSGDQVFDLYLAAIIATLALFIIGFIRR*
Ga0070735_1092458313300005534Surface SoilMKYASIFITILLIWVAVILMALTRSKASDIFELYLAVIVSTLALFLI
Ga0068853_10007764723300005539Corn RhizosphereMKYASIFATILFIWIATIIMAATTTDAHQIYGLYLATIISTLALFIIGFARK*
Ga0068855_10002221763300005563Corn RhizosphereMKYASIFGTILFIWIAVIIMAATTTDAHQIYGLYLACIVSTLALFIIGFARK*
Ga0068863_10210044313300005841Switchgrass RhizosphereMEQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK*
Ga0068858_10011054943300005842Switchgrass RhizosphereMEMKYISIFFTILFIWIAVIFMAFTRDNTNEIFDLYLAVMASTLVLFLIGFGKK*
Ga0068858_10017621823300005842Switchgrass RhizosphereMGQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK*
Ga0068862_10011784343300005844Switchgrass RhizosphereMADPGVAAWRAGIECDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK*
Ga0075363_10015492523300006048Populus EndosphereMKYASIFATILLIWLAVILMAITRRDATDIFELYLTGIVSTMALFLIGFSRRR*
Ga0097621_100000322153300006237Miscanthus RhizosphereMKYASIFATIVLIWIAIILMALTRKSPSDIFELYVSAIVSTLALFLIGFSKR*
Ga0101571_1089670223300006627SoilMKYVSIFATILLIWVAVILMALTSNSSQQIYELYLAVIVCTVALFLIGFARK*
Ga0079223_1092985913300006801Agricultural SoilMKYLSIFFTILFIWVAILLMAVTRDDTGEIFQLYLAVMASTVILFLIGFAKK*
Ga0073934_1005534253300006865Hot Spring SedimentMRYASIFFTILLIWVAIIFMALTRDDPQEIMQLFLAVNFSTLILFLIGFAKK*
Ga0105048_1105618323300009032FreshwaterMKYISIFFTILLIWIAVILMALTREAPTEIFQLFLAAIVSTVVLFLIGFSRK*
Ga0105046_1071958223300009084FreshwaterAIIIMAFTRENTTEIFQLYLAVMGCTIILFLIGFAKK*
Ga0105240_1019350343300009093Corn RhizosphereMKYASIFATILLIWVAVILMAFTSNSATQIYELYLAVIVSTVALFLIGFARK*
Ga0079224_10138117623300009095Agricultural SoilMKYLSIFFTILFIWVAVLLMALTRDDTSEIMQLYLVVMLSTIVLFLIGFAKK*
Ga0079224_10289518123300009095Agricultural SoilMKYLSIFFTILFIWIAVLLMALTRDDTTEIFQLYLAVMVSTVVLFLIGFAKK*
Ga0079224_10389117823300009095Agricultural SoilMKYLSIFFTILFIWVAVILIALTRESSGEIMQLYLAVMVSTVILFMIGFAKK*
Ga0105245_1056548323300009098Miscanthus RhizosphereFLCLSCYTKDTEMKYASIFATILLIWLAVILMAITRKDPTDIFELYVAAIISTAALFLIGFSKK*
Ga0105245_1079215723300009098Miscanthus RhizosphereMKYASIFFTILIIWIATILMALTRSNPDEIFELYLAVTVSTLALFLIGFAKK*
Ga0114981_1058142713300009160Freshwater LakeMKYLSIFLTILFIWIAVILMAFTREKTNEIFQLYLAVMLSTVVLFLIGFAKK*
Ga0114940_1013459913300009448GroundwaterLFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK*
Ga0105249_1302006113300009553Switchgrass RhizosphereCDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK*
Ga0116142_1005524523300009685Anaerobic Digestor SludgeMKYLSIFFTILFIWVAVILMALTRENSSEIFQLYFVVMVSTVILFLIGFAKK*
Ga0136270_100022353300010223FreshwaterMKYASIFFTILFIWLAIIIMAFSSPSTKEVFQLYLTVMLSTIVLFLIGFARK*
Ga0134126_1031317343300010396Terrestrial SoilMKYASIFFTILLIWVAVILMALTQSNGHQVFELYLAVMVSTLALFLIGFARK*
Ga0136596_101236043300011187Saline LakeMRYASIFATILLIWIAVVIMAFTRNSPNEIFELYLAVVVSTLFLFMIGFARR*
Ga0136596_108672223300011187Saline LakeMRYASIFVTILLIWIAVIVMAFTRANPNEIFELYLAVIASTLILFLIGFARK*
Ga0137407_1129332823300012930Vadose Zone SoilMKYASIFATIVLIWVATILMALTRKNPNDIFDLYVAAIVSTLALFLIGFRKR*
Ga0164242_1001530643300012942CompostMKYASIFATILFIWVAVVIMALTTSDVHQIYWLYLSGIISTLALFVIGFARK*
Ga0157369_1105601113300013105Corn RhizosphereMKYASIFATILFIWIAVIIMAFTTKSADQLYALYLACIVSTLALFLIGFARK*
Ga0157374_10000709183300013296Miscanthus RhizosphereMKYASIFATILFIWIAVIIMALTTTDAKQIYGLYLACIVSTLALFLIGFARK*
Ga0157374_1005625143300013296Miscanthus RhizosphereMREMKYASIFATILLIWFAVILMAITRRDPSDIFKLYLAAIISTVALFLIGFTKR*
Ga0157374_1100699013300013296Miscanthus RhizosphereMKYVSVFATIVLIWTAVILMAVTRKDAGQIFELYISAIVSTIAL
Ga0157378_1008858723300013297Miscanthus RhizosphereMKYASIFFTILIIWIATILMALTRSDPGEIFDLYIAVTVSTLALFLIGFAKK*
Ga0157378_1291368423300013297Miscanthus RhizosphereMKYASIFFTILIIWIATILMALTRHNPNEIFELYLAVTISTLALFLIGFAK
Ga0181530_1010630743300014159BogMKYASIFFTILFIWVAVILMALTRRNSSEIFQLYLAVIASTLALFLIGFARK*
Ga0181523_1050909523300014165BogKYASIFFTILFIWVAVILMALTRRNSGEIFELYLAVIASTLALFLIGFARK*
Ga0181526_1060678923300014200BogMKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK*
Ga0172379_1008762113300014208GroundwaterITILFIWVAVILMALTRHDAKEIFQLYIAVMVCTLALFLIGFGKK*
Ga0163163_1002967753300014325Switchgrass RhizosphereMEQMKYLSIFFTILFIWVAVILMALTRDNTSQIFQLYLAVMVSTIVLFLIGFAKK*
Ga0163163_1009298723300014325Switchgrass RhizosphereMKYASIFATIVLIWIAIILMATTRSGATQAFELYITAIICTFALFIIGFSRR*
Ga0157377_1008225933300014745Miscanthus RhizosphereMKYVSVFATIVLIWTAVILMAVTRKDAGQIFELYISAIVSTIALFLIGFSKQ*
Ga0157379_1255501013300014968Switchgrass RhizosphereMRYASIFATILFIWVAVIVMALTTNSASQIYGLYLAAIVSTVAMFLI
Ga0167654_104750123300015084Glacier Forefield SoilMKYVSIFFTILLIWIAVILMAFTRSDTNQLFQLYLTAIVSTVVLFLIGFAKK*
Ga0187847_1002024653300017948PeatlandMKYASTFFTILLIWVAVILMSLTINNSGQVFELFVAVMISTLMLFLIGFGGRA
Ga0193753_1005188623300020034SoilMKYISIFFTILFIWIAVIFMAFSRNNTNEIFELYLAVMFSTLILFLIGFGKK
Ga0193753_1018692633300020034SoilMRYASIFFTILFIWLAVILIALTRHSSGEIFELYLAVMVCTVLLFLIGFGKKQ
Ga0210401_1160255223300020583SoilFMKYASTFFTILLIWIAVILMSLTVHDSGQVFELYVAVMVSTLLLFLIGFGRA
Ga0210388_1114168713300021181SoilYNSKSMKYASIFFTIVLIWIAVILMAASRSSSGEIFQLYVAAIISTLALFLIGFTKK
(restricted) Ga0224722_1001310103300021518Freshwater SedimentMKYLSIFFTILFIWIAVIFMALTRDRTSEIFQLYLAVMLSTVVLFLIGFAKK
Ga0247817_1028377923300022751Plant LitterMKYLSIFFTILFIWVAVILMAITRDDSAEIFQLYLAVMVSTLVLFLIGFAKK
Ga0224558_1004785123300023090SoilMKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK
Ga0247736_1007707523300023095Plant LitterMKYISIFFTILFIWIAVIFMAFSRSNTNEIFELYLAVMVSTLVLFLIGFGKK
Ga0209172_1007326533300025310Hot Spring SedimentMRYASIFFTILLIWVAIIFMALTRDDPQEIMQLFLAVNFSTLILFLIGFAKK
Ga0209542_1027948023300025323SoilMRYASIFFTILFIWLAVVLMALTRHNSSEIFELYIAVMICTVLLFLIGFGKK
Ga0209587_119883823300025721Arctic Peat SoilMKYVSIFFTILLIWIAIILMAITRNNPTEIFELFLAAIGSTVVLFLIGFARK
Ga0209096_110687913300025859Anaerobic Digestor SludgeMKYLSIFFTILFIWVAVILMALTRENSSEIFQLYFVV
Ga0209605_108700513300025861Anaerobic Digestor SludgeLFIWIAVLLMALTRDDTTEIFQLYLAVMVSTVVLFLIGFAKK
Ga0207695_1024218423300025913Corn RhizosphereSIFATILLIWVAVILMAFTSNSATQIYELYLAVIVSTVALFLIGFARK
Ga0207652_1101733523300025921Corn RhizosphereMKYASIFLTIVFIWIAVIIMAFTRSSGDQVFDLYLAAIIATLALFIIGFIRR
Ga0207687_100000081333300025927Miscanthus RhizosphereMKYASIFATIVLIWIAIILMALTRKSPSDIFELYVSAIVSTLALFLIGFSKR
Ga0207687_1097375333300025927Miscanthus RhizosphereMKYASIFFTILIIWIATILMALTRSNPDEIFELYLAVTVSTLALFLIGFAKK
Ga0207687_1118848713300025927Miscanthus RhizosphereMRYASIFFTILFIWLAVILMALTRHKSGEIFELYIAVMTCTVLL
Ga0207689_1089875423300025942Miscanthus RhizosphereMKYASIFATIVLIWLAVVLMATTRGDAKEVFELYVTAIISTLVLFVIGFGKR
Ga0207667_1175030213300025949Corn RhizosphereMKYASIFGTILFIWIAVIIMAATTTDAHQIYGLYLACIVSTLALFIIGFARK
Ga0207651_1209969913300025960Switchgrass RhizosphereSKCCIINVIMKYASIFFTILIIWIATILMALTRTNPNEIFELYLAVIISTLALFLIGFAK
Ga0207668_1010538943300025972Switchgrass RhizosphereMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK
Ga0207668_1015861723300025972Switchgrass RhizosphereMKYISIFFTILFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK
Ga0207658_1012759123300025986Switchgrass RhizosphereMGQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK
Ga0207703_1008994623300026035Switchgrass RhizosphereMEMKYISIFFTILFIWIAVIFMAFTRDNTNEIFDLYLAVMASTLVLFLIGFGKK
Ga0207639_1005505443300026041Corn RhizosphereMKYASIFATILFIWIATIIMAATTTDAHQIYGLYLATIISTLALFIIGFARK
Ga0207702_1207562613300026078Corn RhizosphereIVLIWVAVILMATTRHDPTQIFQLYLTAIVCTIALFFIGFARR
(restricted) Ga0247836_120369823300027728FreshwaterMKYLSIFFTILFIWIAVILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK
Ga0209166_1004936713300027857Surface SoilMKYASIFATIVLIWVAIILMATTRSAVHQIFELYITGIVSTFALFIIGFSRR
Ga0209023_10001379173300027870Freshwater And SedimentMKYISIFFTILLIWIAIVLMAFTRSSATEVFELFLAAIASTVILFLIGFKRK
Ga0306906_103167233300028374Saline LakeMRYASIFATILLIWIAVVIMAFTRNSPNEIFELYLAVVVSTLFLFMIGFARR
Ga0268265_1008634623300028380Switchgrass RhizosphereMADPGVAAWRAGIECDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK
(restricted) Ga0247832_112333513300028557FreshwaterYDKISYRMKYLSIFFTILFIWIAVILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK
(restricted) Ga0247844_1001224433300028571FreshwaterVILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK
Ga0265338_10001602133300028800RhizosphereMKYASVFATIVLIWIAVILMAVTRTAAHKIFELYLTAIFSTLVLFLIGFTRS
Ga0265338_1014087433300028800RhizosphereMKYASIFFTILLIWIAVILMALTRTNANDIFDLYLAVIVSTLALFLIGFARK
Ga0311371_1113832313300029951PalsaIVLIWIAIILMAATRSVPSEIFKLYVAAIISTLSLFLIGFTRS
Ga0265331_1017027723300031250RhizosphereMKYISIFFTILLIWVAVILMAFTRNDSREIFELFLAAIASTVVLFLIGFTRK
Ga0302326_1082514023300031525PalsaMKYASIFATILMIWVAVILMAVTRKSAHEIFDLYVSAILSTLALFLIGFSKR
Ga0335394_1071029523300032456FreshwaterMLPMKYASIFFTILFIWLAIIIMAFTRSDTNEIFQLYLVVMACTVILFLIGFAKK
Ga0335074_1146944413300032895SoilMKYASIFVTIVLIWIAVILMAVTRHQANAIFELYVAAMASTLMLFLIGFSRK
Ga0335072_1008084143300032898SoilMKYVSVFATIVLIWIAVILMAATRSVPSEIFKLYIAAIISTLALFLIGFTRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.