Basic Information | |
---|---|
Family ID | F018543 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 234 |
Average Sequence Length | 44 residues |
Representative Sequence | MWPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR |
Number of Associated Samples | 186 |
Number of Associated Scaffolds | 228 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 62.17 % |
% of genes near scaffold ends (potentially truncated) | 38.89 % |
% of genes from short scaffolds (< 2000 bps) | 81.62 % |
Associated GOLD sequencing projects | 175 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.821 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.402 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.650 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (26.923 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 228 Family Scaffolds |
---|---|---|
PF14534 | DUF4440 | 2.19 |
PF13495 | Phage_int_SAM_4 | 2.19 |
PF12681 | Glyoxalase_2 | 1.75 |
PF07883 | Cupin_2 | 1.75 |
PF13669 | Glyoxalase_4 | 1.75 |
PF12695 | Abhydrolase_5 | 1.32 |
PF08327 | AHSA1 | 1.32 |
PF02371 | Transposase_20 | 0.88 |
PF00589 | Phage_integrase | 0.88 |
PF13460 | NAD_binding_10 | 0.88 |
PF09720 | Unstab_antitox | 0.88 |
PF00574 | CLP_protease | 0.88 |
PF14206 | Cys_rich_CPCC | 0.88 |
PF07617 | DUF1579 | 0.44 |
PF03691 | UPF0167 | 0.44 |
PF14690 | zf-ISL3 | 0.44 |
PF13561 | adh_short_C2 | 0.44 |
PF13637 | Ank_4 | 0.44 |
PF09912 | DUF2141 | 0.44 |
PF00583 | Acetyltransf_1 | 0.44 |
PF06525 | SoxE | 0.44 |
PF12158 | DUF3592 | 0.44 |
PF00400 | WD40 | 0.44 |
PF03705 | CheR_N | 0.44 |
PF02041 | Auxin_BP | 0.44 |
PF09721 | Exosortase_EpsH | 0.44 |
PF12263 | DUF3611 | 0.44 |
PF06983 | 3-dmu-9_3-mt | 0.44 |
PF08922 | DUF1905 | 0.44 |
PF00145 | DNA_methylase | 0.44 |
PF01339 | CheB_methylest | 0.44 |
PF13302 | Acetyltransf_3 | 0.44 |
PF00135 | COesterase | 0.44 |
PF14552 | Tautomerase_2 | 0.44 |
PF03886 | ABC_trans_aux | 0.44 |
PF10531 | SLBB | 0.44 |
PF00266 | Aminotran_5 | 0.44 |
PF16586 | DUF5060 | 0.44 |
PF12146 | Hydrolase_4 | 0.44 |
PF10947 | DUF2628 | 0.44 |
PF01408 | GFO_IDH_MocA | 0.44 |
PF03412 | Peptidase_C39 | 0.44 |
PF05013 | FGase | 0.44 |
PF08448 | PAS_4 | 0.44 |
PF06769 | YoeB_toxin | 0.44 |
PF10137 | TIR-like | 0.44 |
PF04828 | GFA | 0.44 |
PF13905 | Thioredoxin_8 | 0.44 |
PF00484 | Pro_CA | 0.44 |
PF13649 | Methyltransf_25 | 0.44 |
PF01872 | RibD_C | 0.44 |
PF01344 | Kelch_1 | 0.44 |
PF13644 | DKNYY | 0.44 |
PF02817 | E3_binding | 0.44 |
PF09603 | Fib_succ_major | 0.44 |
PF13231 | PMT_2 | 0.44 |
PF00857 | Isochorismatase | 0.44 |
PF02913 | FAD-oxidase_C | 0.44 |
PF02894 | GFO_IDH_MocA_C | 0.44 |
PF10453 | NUFIP1 | 0.44 |
PF00782 | DSPc | 0.44 |
PF12120 | Arr-ms | 0.44 |
PF01844 | HNH | 0.44 |
PF00702 | Hydrolase | 0.44 |
PF02259 | FAT | 0.44 |
COG ID | Name | Functional Category | % Frequency in 228 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 0.88 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.88 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.44 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.44 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.44 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.44 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.44 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.44 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.44 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.44 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.44 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.44 |
COG3196 | Colicin E2 tolerance protein CbrC, UPF0167 family | General function prediction only [R] | 0.44 |
COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.44 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.44 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.44 |
COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.44 |
COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.68 % |
Unclassified | root | N/A | 36.32 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY01DML9A | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
2199352012|2200818384 | Not Available | 816 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10058335 | Not Available | 1016 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105638338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19 | 1304 | Open in IMG/M |
3300000754|JGI11851J11668_1004445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 601 | Open in IMG/M |
3300000956|JGI10216J12902_101645805 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300000956|JGI10216J12902_106938648 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter suwonensis | 568 | Open in IMG/M |
3300002182|JGI24721J26819_10075110 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300002231|KVRMV2_101984993 | Not Available | 518 | Open in IMG/M |
3300002835|B570J40625_100793268 | Not Available | 833 | Open in IMG/M |
3300003313|P32013IDBA_1097842 | Not Available | 622 | Open in IMG/M |
3300003313|P32013IDBA_1157337 | Not Available | 534 | Open in IMG/M |
3300003890|Ga0063162_1004272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1162 | Open in IMG/M |
3300003995|Ga0055438_10187690 | Not Available | 625 | Open in IMG/M |
3300004019|Ga0055439_10267009 | Not Available | 561 | Open in IMG/M |
3300004022|Ga0055432_10145796 | Not Available | 654 | Open in IMG/M |
3300004463|Ga0063356_105108564 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi → Pirellula staleyi DSM 6068 | 564 | Open in IMG/M |
3300004622|Ga0058865_1279510 | Not Available | 503 | Open in IMG/M |
3300004623|Ga0058869_1474847 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 883 | Open in IMG/M |
3300004643|Ga0062591_100882360 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rubripirellula → Rubripirellula tenax | 836 | Open in IMG/M |
3300005077|Ga0071116_1056679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2376 | Open in IMG/M |
3300005093|Ga0062594_103332463 | Not Available | 505 | Open in IMG/M |
3300005171|Ga0066677_10339961 | Not Available | 859 | Open in IMG/M |
3300005179|Ga0066684_10066857 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300005183|Ga0068993_10301809 | Not Available | 579 | Open in IMG/M |
3300005286|Ga0065721_10068896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3314 | Open in IMG/M |
3300005332|Ga0066388_100634835 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300005332|Ga0066388_103596958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter luteus | 791 | Open in IMG/M |
3300005334|Ga0068869_100371789 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300005434|Ga0070709_10587672 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005446|Ga0066686_10813189 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005451|Ga0066681_10787319 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005454|Ga0066687_10666159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
3300005456|Ga0070678_101689650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 596 | Open in IMG/M |
3300005467|Ga0070706_100000530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 44342 | Open in IMG/M |
3300005468|Ga0070707_100307110 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 1542 | Open in IMG/M |
3300005540|Ga0066697_10388144 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae | 811 | Open in IMG/M |
3300005576|Ga0066708_10120517 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300005576|Ga0066708_10465635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
3300005598|Ga0066706_10602763 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Aeoliella → Aeoliella mucimassa | 872 | Open in IMG/M |
3300005617|Ga0068859_100427883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1420 | Open in IMG/M |
3300005617|Ga0068859_100607380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1187 | Open in IMG/M |
3300005627|Ga0077107_108248 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300005764|Ga0066903_100192630 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3032 | Open in IMG/M |
3300005764|Ga0066903_108285148 | Not Available | 531 | Open in IMG/M |
3300005827|Ga0074478_1422256 | Not Available | 1318 | Open in IMG/M |
3300005827|Ga0074478_1469989 | Not Available | 582 | Open in IMG/M |
3300005829|Ga0074479_10488207 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005830|Ga0074473_10880834 | All Organisms → cellular organisms → Bacteria | 5998 | Open in IMG/M |
3300005836|Ga0074470_10137027 | Not Available | 943 | Open in IMG/M |
3300005844|Ga0068862_101858748 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Posidoniimonas → Posidoniimonas polymericola | 612 | Open in IMG/M |
3300005890|Ga0075285_1045213 | Not Available | 581 | Open in IMG/M |
3300005986|Ga0075152_10127136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1476 | Open in IMG/M |
3300005988|Ga0075160_10536914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 629 | Open in IMG/M |
3300006046|Ga0066652_100245353 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300006046|Ga0066652_100795827 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300006056|Ga0075163_10225629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2167 | Open in IMG/M |
3300006056|Ga0075163_10298579 | Not Available | 1832 | Open in IMG/M |
3300006056|Ga0075163_10641168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1141 | Open in IMG/M |
3300006086|Ga0075019_10652580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 663 | Open in IMG/M |
3300006417|Ga0069787_10411670 | All Organisms → cellular organisms → Bacteria | 7090 | Open in IMG/M |
3300006642|Ga0075521_10698401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
3300006791|Ga0066653_10196886 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300006871|Ga0075434_101869051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300006904|Ga0075424_100662101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1115 | Open in IMG/M |
3300007614|Ga0102946_1340070 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 561 | Open in IMG/M |
3300007987|Ga0100379_10266397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 868 | Open in IMG/M |
3300009009|Ga0105105_10538019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 673 | Open in IMG/M |
3300009009|Ga0105105_10538019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 673 | Open in IMG/M |
3300009037|Ga0105093_10002811 | All Organisms → cellular organisms → Bacteria | 6770 | Open in IMG/M |
3300009053|Ga0105095_10015866 | All Organisms → cellular organisms → Bacteria | 4052 | Open in IMG/M |
3300009078|Ga0105106_10032070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3886 | Open in IMG/M |
3300009082|Ga0105099_10187559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1179 | Open in IMG/M |
3300009137|Ga0066709_100025509 | All Organisms → cellular organisms → Bacteria | 6105 | Open in IMG/M |
3300009153|Ga0105094_10018881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3727 | Open in IMG/M |
3300009166|Ga0105100_10092520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1773 | Open in IMG/M |
3300009166|Ga0105100_10385115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium Tous-C4TDCM | 847 | Open in IMG/M |
3300009179|Ga0115028_10913063 | Not Available | 696 | Open in IMG/M |
3300009235|Ga0103857_10054293 | Not Available | 765 | Open in IMG/M |
3300009455|Ga0114939_10009851 | All Organisms → cellular organisms → Bacteria | 5146 | Open in IMG/M |
3300009685|Ga0116142_10175930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1107 | Open in IMG/M |
3300009868|Ga0130016_10495790 | Not Available | 783 | Open in IMG/M |
3300009873|Ga0131077_10104107 | All Organisms → cellular organisms → Bacteria | 4180 | Open in IMG/M |
3300009873|Ga0131077_10275469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1697 | Open in IMG/M |
3300010313|Ga0116211_1153944 | Not Available | 594 | Open in IMG/M |
3300010355|Ga0116242_10211574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1917 | Open in IMG/M |
3300010355|Ga0116242_10861109 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300010396|Ga0134126_11304967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 804 | Open in IMG/M |
3300010408|Ga0137020_100287 | Not Available | 1093 | Open in IMG/M |
3300010863|Ga0124850_1056872 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300010868|Ga0124844_1040002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1577 | Open in IMG/M |
3300010938|Ga0137716_10124823 | Not Available | 1829 | Open in IMG/M |
3300010938|Ga0137716_10124823 | Not Available | 1829 | Open in IMG/M |
3300010938|Ga0137716_10124823 | Not Available | 1829 | Open in IMG/M |
3300010938|Ga0137716_10415576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter debontii | 641 | Open in IMG/M |
3300010938|Ga0137716_10428172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 625 | Open in IMG/M |
3300011399|Ga0137466_1062882 | Not Available | 587 | Open in IMG/M |
3300011425|Ga0137441_1117269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 654 | Open in IMG/M |
3300011428|Ga0137456_1164231 | Not Available | 598 | Open in IMG/M |
3300011442|Ga0137437_1069778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer → unclassified Microbulbifer → Microbulbifer sp. THAF38 | 1198 | Open in IMG/M |
3300012018|Ga0119867_1114244 | Not Available | 723 | Open in IMG/M |
3300012020|Ga0119869_1201941 | Not Available | 604 | Open in IMG/M |
3300012129|Ga0137345_1035655 | Not Available | 632 | Open in IMG/M |
3300012350|Ga0137372_10116098 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
3300012685|Ga0137397_10282620 | Not Available | 1236 | Open in IMG/M |
3300012931|Ga0153915_10587361 | All Organisms → cellular organisms → Archaea | 1280 | Open in IMG/M |
3300012956|Ga0154020_10088503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 3069 | Open in IMG/M |
3300012956|Ga0154020_10194144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1878 | Open in IMG/M |
3300012956|Ga0154020_10317222 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300012956|Ga0154020_10481386 | Not Available | 1043 | Open in IMG/M |
3300012956|Ga0154020_10534546 | Not Available | 973 | Open in IMG/M |
3300012956|Ga0154020_10599922 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 902 | Open in IMG/M |
3300012956|Ga0154020_10845461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 719 | Open in IMG/M |
3300012956|Ga0154020_10864020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Terrimicrobiia → Terrimicrobiales → Terrimicrobiaceae → Terrimicrobium → Terrimicrobium sacchariphilum | 709 | Open in IMG/M |
3300012956|Ga0154020_11197506 | Not Available | 574 | Open in IMG/M |
3300012956|Ga0154020_11237264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
3300012956|Ga0154020_11242300 | Not Available | 561 | Open in IMG/M |
3300012956|Ga0154020_11253034 | Not Available | 558 | Open in IMG/M |
3300012956|Ga0154020_11291342 | Not Available | 547 | Open in IMG/M |
3300012971|Ga0126369_11154878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
3300012971|Ga0126369_11270219 | Not Available | 826 | Open in IMG/M |
3300012984|Ga0164309_10112807 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300012984|Ga0164309_10704304 | Not Available | 802 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10017313 | All Organisms → cellular organisms → Bacteria | 6253 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10419311 | Not Available | 668 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10614221 | Not Available | 699 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_10066631 | All Organisms → cellular organisms → Bacteria | 3597 | Open in IMG/M |
3300013315|Ga0173609_10023542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118 | 613 | Open in IMG/M |
3300014166|Ga0134079_10075876 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300014301|Ga0075323_1071837 | Not Available | 707 | Open in IMG/M |
3300014313|Ga0075347_1095143 | Not Available | 667 | Open in IMG/M |
3300014319|Ga0075348_1014057 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300014498|Ga0182019_10273302 | Not Available | 1119 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10167859 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300014883|Ga0180086_1117097 | Not Available | 685 | Open in IMG/M |
3300015357|Ga0134072_10028459 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300015371|Ga0132258_11479109 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300016357|Ga0182032_10820670 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300016445|Ga0182038_11638577 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300017788|Ga0169931_10637627 | Not Available | 715 | Open in IMG/M |
3300018089|Ga0187774_10655823 | Not Available | 688 | Open in IMG/M |
3300018429|Ga0190272_10245616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1338 | Open in IMG/M |
3300018469|Ga0190270_10846926 | Not Available | 926 | Open in IMG/M |
3300018482|Ga0066669_10133721 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300019222|Ga0179957_1196252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118 | 1914 | Open in IMG/M |
3300019487|Ga0187893_10038429 | All Organisms → cellular organisms → Bacteria | 5181 | Open in IMG/M |
3300020012|Ga0193732_1005404 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
3300020048|Ga0207193_1780343 | Not Available | 612 | Open in IMG/M |
3300020084|Ga0194110_10411647 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300020109|Ga0194112_10259566 | Not Available | 1348 | Open in IMG/M |
3300020109|Ga0194112_10651602 | Not Available | 710 | Open in IMG/M |
3300020172|Ga0211729_11045991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1941 | Open in IMG/M |
3300020193|Ga0194131_10067683 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300020193|Ga0194131_10081698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1862 | Open in IMG/M |
3300020193|Ga0194131_10291497 | Not Available | 741 | Open in IMG/M |
3300020214|Ga0194132_10061836 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
3300021325|Ga0210301_1408967 | Not Available | 1427 | Open in IMG/M |
3300021339|Ga0193706_1004697 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter vanneervenii | 5263 | Open in IMG/M |
3300022563|Ga0212128_10463584 | Not Available | 778 | Open in IMG/M |
3300022911|Ga0247783_1029982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1419 | Open in IMG/M |
3300023102|Ga0247754_1064560 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Calycomorphotria → Calycomorphotria hydatis | 860 | Open in IMG/M |
3300025116|Ga0209207_1060877 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 809 | Open in IMG/M |
3300025130|Ga0209594_1007112 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 4747 | Open in IMG/M |
3300025533|Ga0208584_1129473 | Not Available | 585 | Open in IMG/M |
3300025918|Ga0207662_10557316 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300025936|Ga0207670_10391589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1109 | Open in IMG/M |
3300026050|Ga0208293_1013783 | Not Available | 569 | Open in IMG/M |
3300026075|Ga0207708_11572969 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula | 578 | Open in IMG/M |
3300026330|Ga0209473_1037039 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
3300026342|Ga0209057_1230306 | Not Available | 526 | Open in IMG/M |
3300026377|Ga0257171_1067588 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300026551|Ga0209648_10171102 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
3300026552|Ga0209577_10020026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5927 | Open in IMG/M |
3300027713|Ga0209286_1002123 | All Organisms → cellular organisms → Bacteria | 6378 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1123208 | Not Available | 1183 | Open in IMG/M |
3300027731|Ga0209592_1022172 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
3300027770|Ga0209086_10134426 | Not Available | 1217 | Open in IMG/M |
3300027797|Ga0209107_10061205 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
3300027873|Ga0209814_10258441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300027896|Ga0209777_10631257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 771 | Open in IMG/M |
3300027975|Ga0209391_10301320 | Not Available | 636 | Open in IMG/M |
3300028041|Ga0247719_1057776 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300028536|Ga0137415_11266410 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 554 | Open in IMG/M |
3300028558|Ga0265326_10015967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2173 | Open in IMG/M |
3300028590|Ga0247823_10343203 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300028881|Ga0307277_10305951 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300031456|Ga0307513_10804679 | Not Available | 646 | Open in IMG/M |
3300031469|Ga0170819_12948613 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 537 | Open in IMG/M |
3300031545|Ga0318541_10270296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300031572|Ga0318515_10665879 | Not Available | 552 | Open in IMG/M |
3300031719|Ga0306917_10438767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
3300031720|Ga0307469_10715267 | Not Available | 910 | Open in IMG/M |
3300031726|Ga0302321_102878888 | Not Available | 562 | Open in IMG/M |
3300031744|Ga0306918_10136422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1797 | Open in IMG/M |
3300031797|Ga0318550_10418134 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300031798|Ga0318523_10454703 | Not Available | 635 | Open in IMG/M |
3300031873|Ga0315297_11592969 | Not Available | 525 | Open in IMG/M |
3300031879|Ga0306919_10042811 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
3300031890|Ga0306925_10079986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3453 | Open in IMG/M |
3300031902|Ga0302322_103157157 | Not Available | 566 | Open in IMG/M |
3300031910|Ga0306923_10165931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2522 | Open in IMG/M |
3300032144|Ga0315910_10719929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 775 | Open in IMG/M |
3300032144|Ga0315910_11143447 | Not Available | 608 | Open in IMG/M |
3300032144|Ga0315910_11188565 | Not Available | 595 | Open in IMG/M |
3300032144|Ga0315910_11188565 | Not Available | 595 | Open in IMG/M |
3300032144|Ga0315910_11436845 | Not Available | 538 | Open in IMG/M |
3300032157|Ga0315912_10015837 | All Organisms → cellular organisms → Bacteria | 6258 | Open in IMG/M |
3300032157|Ga0315912_10015837 | All Organisms → cellular organisms → Bacteria | 6258 | Open in IMG/M |
3300032157|Ga0315912_10015837 | All Organisms → cellular organisms → Bacteria | 6258 | Open in IMG/M |
3300032157|Ga0315912_10129496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1977 | Open in IMG/M |
3300032157|Ga0315912_10250434 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Roseivirgaceae → Roseivirga → Roseivirga seohaensis | 1393 | Open in IMG/M |
3300032157|Ga0315912_10983375 | Not Available | 670 | Open in IMG/M |
3300032157|Ga0315912_11227477 | Not Available | 593 | Open in IMG/M |
3300032157|Ga0315912_11358580 | Not Available | 561 | Open in IMG/M |
3300032397|Ga0315287_11387154 | Not Available | 800 | Open in IMG/M |
3300032770|Ga0335085_10530282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
3300032782|Ga0335082_11440439 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 559 | Open in IMG/M |
3300032805|Ga0335078_10985684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1000 | Open in IMG/M |
3300032893|Ga0335069_10689893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
3300032897|Ga0335071_11444661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 632 | Open in IMG/M |
3300033004|Ga0335084_10949400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Anthocerotibacter → Anthocerotibacter panamensis | 868 | Open in IMG/M |
3300033004|Ga0335084_11078548 | Not Available | 806 | Open in IMG/M |
3300033485|Ga0316626_11860875 | Not Available | 544 | Open in IMG/M |
3300033493|Ga0316631_10519788 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300034018|Ga0334985_0152535 | Not Available | 1575 | Open in IMG/M |
3300034022|Ga0335005_0019156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter yonseiensis | 4815 | Open in IMG/M |
3300034063|Ga0335000_0261100 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300034109|Ga0335051_0080360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1711 | Open in IMG/M |
3300034128|Ga0370490_0003769 | All Organisms → cellular organisms → Bacteria | 5763 | Open in IMG/M |
3300034268|Ga0372943_0239756 | Not Available | 1136 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.27% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 5.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.13% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 2.14% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.14% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 2.14% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.71% |
Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.28% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.28% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
Rice-Straw Enriched Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost | 0.85% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.85% |
Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 0.85% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.43% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.43% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.43% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.43% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.43% |
Crenothrix Polyspora | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Crenothrix Polyspora | 0.43% |
Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.43% |
Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.43% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.43% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.43% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.43% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.43% |
Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.43% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.43% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.43% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.43% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.43% |
Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2199352012 | Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1 | Engineered | Open in IMG/M |
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002182 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003313 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sample | Environmental | Open in IMG/M |
3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004622 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300004623 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time I- 292min-Aaerobic_ RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005286 | Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1 | Engineered | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005627 | Crenothrix polyspora biofilm communities from Wolfenbuettel waterworks, Germany | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
3300007987 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010313 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG | Environmental | Open in IMG/M |
3300010355 | AD_USDVca | Engineered | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010408 | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
3300012020 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge | Engineered | Open in IMG/M |
3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025116 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG (SPAdes) | Environmental | Open in IMG/M |
3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026050 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028041 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_00313280 | 2170459010 | Grass Soil | MSDRSPNQGAAANRRPAGQADGSDNLSATVAADQAFSAAVAELG |
2201445852 | 2199352012 | Rice-Straw Enriched Compost | MNWWANKGAAANRRPAGQWDGSGNLSAIVAADRAFPAAVAELDR |
BS_KBA_SWE12_21mDRAFT_100583352 | 3300000124 | Marine | MTRMPNQSVAANRRPAGQSDGSDNLSAIVVADRAFPAAVAELDR* |
INPhiseqgaiiFebDRAFT_1056383383 | 3300000364 | Soil | GAAANRRPAGQSDGSDNLPAIVAADWEFPAATELGR* |
JGI11851J11668_10044452 | 3300000754 | Soil | MSLSRFRLRREPPNQGAAANRRLAEQSDGSDNLSAIVAADRTFPAAVAELGR* |
JGI10216J12902_1016458052 | 3300000956 | Soil | MSKSKDRANQGAAANRRPAGLSDGSDNLSVIVGADRAFPAAVAELCR* |
JGI10216J12902_1069386482 | 3300000956 | Soil | MDMMMSPNQGAAANRRSAGQLDGSGNLSATLAADRAFPLAVAELDR* |
JGI24721J26819_100751103 | 3300002182 | Hot Spring | MRTWANQSAAANRRPAGQLDGSDNLAAIVAADRAFPAAVAELDRWP* |
KVRMV2_1019849931 | 3300002231 | Marine Sediment | MTWPNQSAAANLRPAGQSDGLGNLFAIVAADRAFPAAVAEL |
B570J40625_1007932682 | 3300002835 | Freshwater | MTPSQSAAANRRPTGQLDGSDNLSATVAADRAFPAAVAELGR* |
P32013IDBA_10978422 | 3300003313 | Ore Pile And Mine Drainage Contaminated Soil | MKAWANQGAAANRRPAWQSNGADNVSATVATDRAFPAAVAELGR* |
P32013IDBA_11573372 | 3300003313 | Ore Pile And Mine Drainage Contaminated Soil | MKAWANQGAAANRRPAGQSDGLGNVFATVAADRAFPAAVAELGR* |
Ga0063162_10042721 | 3300003890 | Hot Spring Sediments | QESEFHDMMPNQCAAANRRPAGQSDGSGNLAATVAADRAFPAAVAELGR* |
Ga0055438_101876901 | 3300003995 | Natural And Restored Wetlands | MEFLSIVSEWANQSAAANRRPAGQSDSSGNLAAIVAADRAFPAAVAELGR* |
Ga0055439_102670091 | 3300004019 | Natural And Restored Wetlands | NQSAAANRRPAGQSDGSGNLAAIVAAARAFPAAVAELGR* |
Ga0055432_101457962 | 3300004022 | Natural And Restored Wetlands | MTMLWPNQSAAANRRPAGQSDGAGNLAAIVAAGRAFPAAVAELGR* |
Ga0063356_1051085642 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PNQSAAANRRPAGQADGSDNLSATVAADRVFPAAAVAELGR* |
Ga0058865_12795101 | 3300004622 | Wastewater Treatment | MMWANQSAAANRRPAGQSDGSDNLAATVAADRAFPAAVAELGR* |
Ga0058869_14748472 | 3300004623 | Wastewater Treatment | MMWANQSAAANRRPAGQSDGSDNLAATVAADRAFPAAVAELDRSAK* |
Ga0062591_1008823601 | 3300004643 | Soil | MIALNQSAAANRRPPGQSDGSDNSSAIVASDRAFPAAVAELGR |
Ga0071116_10566792 | 3300005077 | Sinkhole | MNRQPDGAANRRPALQLDGSDNMSAIVAADRVFPAAVAELGRR* |
Ga0062594_1033324632 | 3300005093 | Soil | MREAPPNHGAAANRRTAGQSDGSDNLFETLAADRAFPAAVAELDR* |
Ga0066677_103399611 | 3300005171 | Soil | SMSDGSPNQGAAANRRPAGQSDGSDDLSAIVAADRAFSAAVAELGR* |
Ga0066684_100668573 | 3300005179 | Soil | MSDGSPNQGAAANRRPAGQSDGSDDLSAIVAADRAFSAAVAELGR* |
Ga0068993_103018091 | 3300005183 | Natural And Restored Wetlands | GASGRLQMEFLSIVSEWANQGAAANRRPAGQSDGAGNLAAIVAAGRAFPAAVAELGR* |
Ga0065721_100688964 | 3300005286 | Rice-Straw Enriched Compost | MNWWANKGAAANRRPAGQWDGSGNLSAIVAADRAFPAAVAELDR* |
Ga0066388_1006348354 | 3300005332 | Tropical Forest Soil | MTTWPNQSAGANRRPAGQSDGSDNLSAIVAADRAFPAAVAELGR* |
Ga0066388_1035969581 | 3300005332 | Tropical Forest Soil | PNQGAAANRRPAEQADGSDNLSATLAADRALPAAVAELGR* |
Ga0068869_1003717892 | 3300005334 | Miscanthus Rhizosphere | MMSNQGVAANCRAAGLSDGADNFSAIVAADRAFPAAVAELGRSDED* |
Ga0070709_105876723 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVVAANQGAPANRRPAGLSDGSDNLTATVAVDRAFPAAVAEL |
Ga0066686_108131891 | 3300005446 | Soil | PNQSAAANRRPAGQLDGSGDLAAIVAADRAFPAAVAELGR* |
Ga0066681_107873192 | 3300005451 | Soil | MSDRSPNQRAAANLRTAGQSDGSNNLSAPLAAALAFPATVVELDR* |
Ga0066687_106661592 | 3300005454 | Soil | MSSIFSVTMTTWPNQDAAANRRPAGQSDGSDNLSAIVAADRAFPGAVAELDR* |
Ga0070678_1016896501 | 3300005456 | Miscanthus Rhizosphere | MEFWEDTMTPNQSAAANRRPTGQLDGSGNLSAIVAADRAFPAAVAELGR* |
Ga0070706_10000053020 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGFKKVFMSMLPNEGAAANRRPAGQSDGLDNLSATVAADRAFPAAVAELDR* |
Ga0070707_1003071104 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWANKGAAANRRPAGQSSGSGNLSATLAADRAFPAAVAELGR* |
Ga0066697_103881442 | 3300005540 | Soil | MSDRSPNQGAAANRRPAGQSDGSDDLEAIVAADRAFPAAVAELGR* |
Ga0066708_101205172 | 3300005576 | Soil | MSDRSPNQGAAANRRPAGQSDGSDDLSAIVAADRAFSAAVAELGR* |
Ga0066708_104656352 | 3300005576 | Soil | MSDRSPNRGAAANLRTAGQSDGSDNLSAPLAAARAFSATVVELDH* |
Ga0066706_106027632 | 3300005598 | Soil | MFMDSSPNNGARANRRPAVQASGSDKLSAAVAADRALPAAV |
Ga0068859_1004278833 | 3300005617 | Switchgrass Rhizosphere | MILASNQRAAANRRPAGQSDGGDNLSAMVAAGRAFPAA |
Ga0068859_1006073803 | 3300005617 | Switchgrass Rhizosphere | MMSNQGAAANCRAAGLSDGADNFSAIVAADRAFPAAVAELGRSDED* |
Ga0068864_1013970732 | 3300005618 | Switchgrass Rhizosphere | MSMPPNQGAAANRRPAGQSDGSDNLSAIVAADRAFPAAVAELVRRREFRDARRS* |
Ga0077107_1082483 | 3300005627 | Crenothrix Polyspora | MIETWSNQSAAANRRPAGQADGSDNLSAIVAADRAFPAAVAELGR* |
Ga0066903_1001926303 | 3300005764 | Tropical Forest Soil | PHFVRRGEVRVMNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR* |
Ga0066903_1008485581 | 3300005764 | Tropical Forest Soil | VKRLNQGAAANRRPVAQASGSDYLSATVAADRAFP |
Ga0066903_1082851482 | 3300005764 | Tropical Forest Soil | GEVRVMNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR* |
Ga0074478_14222562 | 3300005827 | Sediment (Intertidal) | MKTWPNQSAAANRRPALQSDGLGNLSAIIAADRVFPAAVAELDR* |
Ga0074478_14699891 | 3300005827 | Sediment (Intertidal) | RRLALMRNMLRRSQTKALDRPAGQSDGSGNLFATVAADRAFPAAVAELGR* |
Ga0074479_104882072 | 3300005829 | Sediment (Intertidal) | MSQSPNRQSAPAKRRPALQSDGSDNLAAIVAADRALPAAVAERYA* |
Ga0074473_108808347 | 3300005830 | Sediment (Intertidal) | AGFNQSAAANRRPAGQLDGPDNLSAIVAADRAFPAAVAELVRRYGV* |
Ga0074470_101370272 | 3300005836 | Sediment (Intertidal) | MTTTLANQGANRRPAGQSDGSDNLSATLAAERAFPAAVVDLSLGVIHAP* |
Ga0068862_1018587482 | 3300005844 | Switchgrass Rhizosphere | MMSNQGAAANCRAAGLSDGADNFSAIVAADRAFPAAVAELDR |
Ga0075285_10452131 | 3300005890 | Rice Paddy Soil | MIYTPNQSAAANRRPAGQLDGSGNLFAIVAADRAFSAFAQKL* |
Ga0075152_101271364 | 3300005986 | Wastewater Effluent | MMWANQSAAANRRPAGQSDGSDNLAATVAADRAFPAAVAEL |
Ga0075160_105369141 | 3300005988 | Wastewater Effluent | SAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELDRSASV* |
Ga0066652_1002453534 | 3300006046 | Soil | MTMSDRSPNQGAAANRRPAGQSDGSDDLEAIVAADRAFPAAVAELGR* |
Ga0066652_1007958272 | 3300006046 | Soil | MRSRGRSNHGAAANRRHAGQSDGSDNLSATVAADRAFPATVAEL |
Ga0075163_102256294 | 3300006056 | Wastewater Effluent | MTIMTANQSAAANRRPAGQLAGSGNLLATVAADRAFPAAVAELGR* |
Ga0075163_102985791 | 3300006056 | Wastewater Effluent | MTWPNQSAAANRRPAGQSDGLGNLSATVAADRAFPAAVAELGRLLF |
Ga0075163_106411682 | 3300006056 | Wastewater Effluent | MTQANQSAPSNRRPAGQWDGSSNLLATVAADRAFPAAVADR* |
Ga0075019_106525802 | 3300006086 | Watersheds | MSFKMQPNQSAPANRRPAGQSDGSDNLAAIVAADRAFPAAVAELGR* |
Ga0069787_104116708 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | NRRPAGQLDGSGNLFATLAADRAFPVAVAELGRSAE* |
Ga0075521_106984012 | 3300006642 | Arctic Peat Soil | MTLWPNQSAAANRRPAGQSDGSDNLSAIVAADRAFPAAVAELG |
Ga0066653_101968862 | 3300006791 | Soil | MSDRSPNQGAAANLRTAGQSDGSNNLSAPLAAARAFPATVVELDR* |
Ga0075434_1018690512 | 3300006871 | Populus Rhizosphere | MMPNQSAAANRRPAGQSDGLGNLAATVAADRAFPAAVAELGR* |
Ga0075424_1006621013 | 3300006904 | Populus Rhizosphere | MTPNQSAAANRRPAGQSDGAGNLAATVAADRAFPAAVAELGR* |
Ga0102946_13400702 | 3300007614 | Soil | LPTKECGMTVMPNQSAAANRRPAGQADGSDNLFATVAADRAFPAAVAELGR* |
Ga0100379_102663972 | 3300007987 | Aquifer | MTTQPNQSAAANRRPAGQLDGSGNLLAIVAADRAFPAAVAELGRCLQNTVLH* |
Ga0105105_105380192 | 3300009009 | Freshwater Sediment | MWPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR* |
Ga0105105_105380194 | 3300009009 | Freshwater Sediment | MIMLWSQGAASNRRPAGQSEGADNLSATVAADRAFPAAV |
Ga0066710_1009994701 | 3300009012 | Grasslands Soil | MWPNKGAAANRRAALQSGGSGNLSATVAADRTFPAAV |
Ga0105093_100028117 | 3300009037 | Freshwater Sediment | MTMLWPNQSAAANRRPAGQSDGADNLSAIVAADRAFPAAVAELGR* |
Ga0105095_100158663 | 3300009053 | Freshwater Sediment | MTMLWPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR* |
Ga0105106_100320703 | 3300009078 | Freshwater Sediment | MTPNQGAAANRRPAGQAEGSDNLSAIVAADRAFPAAVAELGRWA* |
Ga0105099_101875591 | 3300009082 | Freshwater Sediment | DLSMTMLWPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR* |
Ga0066709_1000255093 | 3300009137 | Grasslands Soil | MSFRITSPNQSAAVNRRPALQSGGSRDLSAILAADRAFPAAVAELGR* |
Ga0105094_100188814 | 3300009153 | Freshwater Sediment | MTPNQSAAANRRPAGQAEGSDNLSAIVAADRAFPAAVAELGRWA* |
Ga0105100_100925203 | 3300009166 | Freshwater Sediment | MLSPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGRWA* |
Ga0105100_103851151 | 3300009166 | Freshwater Sediment | MTPNQGAAANRRPAGQAEGSDNLSAIVAADRAFPAAVAELGR* |
Ga0115028_109130632 | 3300009179 | Wetland | MTQANQSAAANRRPAGQSDGSGNLAATVAADRAFPAAVAELGRSAMLRALSNPR* |
Ga0103857_100542931 | 3300009235 | River Water | MVSIDRPNQGAAANRRPAGQSDDSGNLAATVAADRAFPAAVAELGR* |
Ga0114939_100098512 | 3300009455 | Groundwater | MTPDQGAAANRRPALQSDGSGNLSATLAADQAFPAAVAQLCRST* |
Ga0116142_101759303 | 3300009685 | Anaerobic Digestor Sludge | MNEQANQSAAANRRPAGQPNGSDNLPAIVAADRAFPAAVAEL* |
Ga0130016_104957901 | 3300009868 | Wastewater | MKEVSAGRPNQGDAANRRPAGQSGGSDNLSATVPAYRAFLARRDS |
Ga0131077_101041072 | 3300009873 | Wastewater | MITPNQSAAANRRPAGQLDGSGNLFAIVAIDRAFPTAVAELGR* |
Ga0131077_102754692 | 3300009873 | Wastewater | MTMTWPNQSTVANRRPAGQLDGLGNLFATVAADRAFPAAVAELGRSLEK* |
Ga0116211_11539441 | 3300010313 | Hot Spring | QCAAANRRPAEQSGGSGNLAAIVATDRALPAAVAELGR* |
Ga0116242_102115744 | 3300010355 | Anaerobic Digestor Sludge | QSAAANRRPAFQLDGLDNLSATVAAARALPAAVAELGRWAKSSAP* |
Ga0116242_108611092 | 3300010355 | Anaerobic Digestor Sludge | MTWPNQSAAANRRPAFQLDGSSNLAAIVAADRAFPAAVAELGRWPEL* |
Ga0134126_113049671 | 3300010396 | Terrestrial Soil | MIDQSPNQSAAANRRPAGQSDGSDNLAATVAADRAFPAADAELDR* |
Ga0137020_1002873 | 3300010408 | Soil | ANQSAAANRRPAGQLDGSDNLFATVAADRAFPAAVAELGR* |
Ga0124850_10568722 | 3300010863 | Tropical Forest Soil | MNESWPNKGAAANRRPAGQLDGAGNLSATVAADRVFPATVAELDR* |
Ga0124844_10400021 | 3300010868 | Tropical Forest Soil | MTPNQGAGANRRPAGQSGRSDNLSAIVAAVRAFPAAVAGLGR* |
Ga0137716_101248231 | 3300010938 | Hot Spring Fe-Si Sediment | MRLTWSNQCAAANRRPAGQVDGSGNLFATVAADRAFPA |
Ga0137716_101248233 | 3300010938 | Hot Spring Fe-Si Sediment | MFGGHFQRQESEFHDMMPNQCAAANRRPAGQSDGSGNLAATVAADRAFPAAVAELGR* |
Ga0137716_101248234 | 3300010938 | Hot Spring Fe-Si Sediment | MTPPNQCAAANRRPAGQLNGSDNLFATVAADRAFPAAVAELGR* |
Ga0137716_104155762 | 3300010938 | Hot Spring Fe-Si Sediment | MTRLTANQGAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR* |
Ga0137716_104281721 | 3300010938 | Hot Spring Fe-Si Sediment | MKSTQANQCAAANRRPAGQADGSDNLSAIVAADRAFPAAVAEL |
Ga0137466_10628821 | 3300011399 | Soil | RGFVHDEPPNQGAAANRRPAGQLDGSGNLAATVAADRAFPAAVAELSR* |
Ga0137441_11172692 | 3300011425 | Soil | MMLANQSAAANRRPAGQADGSGNLAAIVAADRAFPAAVAELGR* |
Ga0137456_11642311 | 3300011428 | Soil | MTMLMPNQSAAADRRPAGQSDGSVNLTATIAADRAFPAAVAELGR* |
Ga0137437_10697782 | 3300011442 | Soil | MRHDKQPNQSAAANRRSAGQSDGSDNLSATVAADQAFPAAVAELVVSRHDT* |
Ga0119867_11142442 | 3300012018 | Activated Sludge | MMMPNQSAAANRRPAGQLDGSGNLSATVAADRAFPAVVAELGR* |
Ga0119869_12019412 | 3300012020 | Activated Sludge | MMMPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR* |
Ga0137345_10356551 | 3300012129 | Soil | PNQSAAANRRPAGQSDGSGSLAAIVAADRAFPAAVAELDR* |
Ga0137372_101160983 | 3300012350 | Vadose Zone Soil | MKTTTPNQGAAANRRPAGQSEGSDNLSATVATDRAFPAAVADLESR* |
Ga0137397_102826202 | 3300012685 | Vadose Zone Soil | MHMTANEGVAANRRPAGQSDGSDNWSAIIAADRAFPAAVAEVCR* |
Ga0153915_105873615 | 3300012931 | Freshwater Wetlands | TPNQSAAVNRRPAGQSDGSDNLFATLAADRAFPAAVAELDRYA* |
Ga0154020_100885033 | 3300012956 | Active Sludge | MSLAPPNHALQRRPAGQSDGSGNLAAIVAAARAFPAAVAELGR* |
Ga0154020_101941442 | 3300012956 | Active Sludge | MTMTWSNQSAAANRRPAGQSDGSGNLFATVAADRAFPAAVAELGR* |
Ga0154020_103172221 | 3300012956 | Active Sludge | MRLPPNQSAASSLRPAGQSDGSGVLAATVAADRAFPTAVAG |
Ga0154020_104813862 | 3300012956 | Active Sludge | MMPNQSAAANRRPAFQSDGSGNLSAIVAADRAFPAAVAELDR* |
Ga0154020_105345462 | 3300012956 | Active Sludge | MIDVMPNQSAAANRRSAGQPDGSGNLFATVAADRAFPAAVAELGR* |
Ga0154020_105999222 | 3300012956 | Active Sludge | MMMPNQSAAANRRPAGQSDGSDNLSATVAADRAFPAAVAELGRSAKKLSL* |
Ga0154020_108454611 | 3300012956 | Active Sludge | NQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR* |
Ga0154020_108640202 | 3300012956 | Active Sludge | MKPNHQGAAAPNRRPAGQSDGSDNLSAIVAADRAFPAAVAEL |
Ga0154020_111975061 | 3300012956 | Active Sludge | MKQANQSAAANRRPAGQLDGSDNLAATVAADRAFPAAVAE |
Ga0154020_112372642 | 3300012956 | Active Sludge | NQSAAANRRHAGQSSGSDNLAAIVAADRAFPAAVAELGR* |
Ga0154020_112423001 | 3300012956 | Active Sludge | MTWSNQSAAANRRPAGQSDGSDNLSATVAADRAFPAAVAEL |
Ga0154020_112530341 | 3300012956 | Active Sludge | AAANRRPAFQSDGSGNLSAIVAADRAFPAAVAELGR* |
Ga0154020_112913422 | 3300012956 | Active Sludge | MTTLMPNQSAAANRRPAGQADGLDNLAAIVAADRAFPAAVAELGR* |
Ga0126369_111548781 | 3300012971 | Tropical Forest Soil | NQGAAANRRPVAQASGSDYLSATVAADRAFPAVVAGLDR* |
Ga0126369_112702191 | 3300012971 | Tropical Forest Soil | RCPHFVRRGEVRVMNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR* |
Ga0164309_101128071 | 3300012984 | Soil | MTWSNQSAAANRRPAGQSDGSGNLLATVAADRAFPAAVAELGR* |
Ga0164309_107043042 | 3300012984 | Soil | MKLTPNQSAAANRRPAGQADGSGNLAATVAADRAFPAAVAELGR* |
(restricted) Ga0172368_100173135 | 3300013123 | Freshwater | MRPNQGAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELDR* |
(restricted) Ga0172369_104193111 | 3300013125 | Freshwater | MRPNQGAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR* |
(restricted) Ga0172372_106142211 | 3300013132 | Freshwater | MSNKDAAANRHPAGQLSGSDDLSATVAVVRAFPAAVAELGRS |
(restricted) Ga0172375_106926091 | 3300013137 | Freshwater | MTRMQANQSAAANRRPAGQADGSGNLSATLAADRAF |
(restricted) Ga0172371_100666313 | 3300013138 | Freshwater | MSPNQGAAANRRPAGQLDGPGNLFATVAGDRAFPAAVAELGR* |
Ga0173609_100235422 | 3300013315 | Sediment | MTMLWPNQLQLRPAEQWDGSGNLAATVAAHRAFPAAVAELGLGAPDVSVS* |
Ga0134079_100758762 | 3300014166 | Grasslands Soil | MSDRSPNQGAAANRRPAGQSDGSDDLEAIVAADRAFSAAVAELGR* |
Ga0075323_10718371 | 3300014301 | Natural And Restored Wetlands | MTMTWPNQIAAATRRPAGQSDGSDNLAATLAADRAFPAAVAELSR* |
Ga0075347_10951431 | 3300014313 | Natural And Restored Wetlands | WSVIMTPPNQGAAANRRPAWQSNGLDNLSATLAAGRAFPAAVAELGR* |
Ga0075348_10140571 | 3300014319 | Natural And Restored Wetlands | MRIVSPNQGAAANRRPALRAGGSENLAATVAADRAFPAAVAELGR* |
Ga0182019_102733022 | 3300014498 | Fen | MAWPNQSAAANRRPAGQLDGSGNLAAIVAADRAFPAAVAQLR* |
(restricted) Ga0172376_101678591 | 3300014720 | Freshwater | DAAANRHPAGQLSGSDDLSATVAVVRAFPAAVAELGR* |
Ga0180086_11170972 | 3300014883 | Soil | MTVLANQSAAANRCPAGQSGGSGNLSATLAADLAFPAAVAELGR* |
Ga0134072_100284593 | 3300015357 | Grasslands Soil | RSPNQGAAANRRPAGQSDGSDDLEAIVAADRAFPAAVAELGR* |
Ga0132258_114791093 | 3300015371 | Arabidopsis Rhizosphere | MSSIFSVTMTTWPNQGAAANRRPAGQSDGSDNLSAIVAADRAFPAAVAELGR* |
Ga0182032_108206703 | 3300016357 | Soil | WPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR |
Ga0182038_116385772 | 3300016445 | Soil | GAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR |
Ga0169931_106376272 | 3300017788 | Freshwater | MSNKDAAANRHPAGQLSGSDDLSATVAVVRAFPAAVAELGRSA |
Ga0187774_106558231 | 3300018089 | Tropical Peatland | MKSWPGQGAAANRCSAGPSDGSGHLSATLAADRAFPAAVAELV |
Ga0190272_102456161 | 3300018429 | Soil | VGRDELSRLPNQRAAANRRPAGQSDGSDNFTATVAADRAFPAA |
Ga0190270_108469263 | 3300018469 | Soil | MQPNQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR |
Ga0066669_101337211 | 3300018482 | Grasslands Soil | PDQISMSDGSPNQGAAANRRPAGQSDGSDDLSAIVAADRAFSAAVAELGR |
Ga0179957_11962524 | 3300019222 | Anaerobic Digestor Sludge | MNEQANQSAAANRRPAGQPNGSDNLPAIVAADRAFPAAVAEL |
Ga0187893_100384297 | 3300019487 | Microbial Mat On Rocks | MTTPSNQGAAANRSSALQSDRADNLSAIVAADWAFPAAVAELGR |
Ga0193732_10054043 | 3300020012 | Soil | MDMMMSPNQGAAANRRSAGQLDGSGNLSATLAADRAFPVAVAELDP |
Ga0207193_17803432 | 3300020048 | Freshwater Lake Sediment | MTMLPTKSVAANRRPALQPDGSGNLPAIVAADRAFPAAVAELGR |
Ga0194110_104116473 | 3300020084 | Freshwater Lake | MAQANQSAAANRRPAGQSDGSGNLSALVAADRAFPAAVAELGR |
Ga0194112_102595662 | 3300020109 | Freshwater Lake | MTMWPNQSAAANRRPAGQSDGSGNLSALVAADRAFPAAVAELGR |
Ga0194112_106516022 | 3300020109 | Freshwater Lake | MSAIFDSSMTMWPNQSAAANGRPAGQLDGSDNWAATVAAGRAFPAAVAELDR |
Ga0211729_110459912 | 3300020172 | Freshwater | MILHWVFTDRPNQSAAANRRPALQSDGSDNLSAIVAAARAFPAAVAELGR |
Ga0194131_100676832 | 3300020193 | Freshwater Lake | MQGPNQIAAANRRPAGQLDGSGNMFATVATDRAFPAAVAELGR |
Ga0194131_100816983 | 3300020193 | Freshwater Lake | MIKQTRMPNKVTGANSRPAGQLDGSGNLAAIVATDRAFPAAVAELDR |
Ga0194131_102914973 | 3300020193 | Freshwater Lake | MTMWPNQSAAANRRPAGQSDGSGNLSALVAADRAFPAAVAELGRSVSLTRPAD |
Ga0194132_100618363 | 3300020214 | Freshwater Lake | MYLEKRRANKGAAANRRHAGQLDGSGNLLAIVAADRAFPAAVAELGRWANN |
Ga0210301_14089674 | 3300021325 | Estuarine | MTHSQSAAANRRPTGQLDGSDNLSATVAADRAFPAAVAELGR |
Ga0193706_10046973 | 3300021339 | Soil | MKRASPNQSAAANRRPAGQSDGSGNLSATVAADRAFPEAVAELGR |
Ga0212128_104635841 | 3300022563 | Thermal Springs | AAANRRPAGQSDGSDNLSAMVAADRTFPAAVAELGR |
Ga0247783_10299822 | 3300022911 | Plant Litter | MTYPNQSAAANRRPAGQASGSDNLAAIIEADRAFPATVAELGR |
Ga0247754_10645602 | 3300023102 | Soil | MRFEIESSNQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR |
Ga0209207_10608771 | 3300025116 | Hot Spring | MSSRKEKMPNKGAAANRRPAGQADGAGNLLATVAADRAFPAAVAELCR |
Ga0209594_10071125 | 3300025130 | Groundwater | MTPDQGAAANRRPALQSDGSGNLSATLAADQAFPAAVAQLCRST |
Ga0208584_11294732 | 3300025533 | Arctic Peat Soil | MPNKCAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR |
Ga0207662_105573162 | 3300025918 | Switchgrass Rhizosphere | MMSNQGAAANCRAAGLSDGADNFSAIVAADRAFPAAVAELGRSDED |
Ga0207670_103915891 | 3300025936 | Switchgrass Rhizosphere | MILASNQRAAANRRPAGQSDGGDNLSAMVAAGRAFPAAVAELDRSA |
Ga0208293_10137831 | 3300026050 | Natural And Restored Wetlands | MILENMWIEPSNQGAAANRRPALQSDGSDNLSATLAADGAFPAAVAELDR |
Ga0207708_115729692 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QSHEMMSNQGVAANCRAAGLSDGADNFSAIVAADRAFPAAVAELGRSDED |
Ga0209473_10370392 | 3300026330 | Soil | MSDGSPNQGAAANRRPAGQSDGSDDLSAIVAADRAFSAAVAELGR |
Ga0209057_12303061 | 3300026342 | Soil | PNQGAAANRRPAGQSDGSDDLEAIVAADRAFPAAVAELGR |
Ga0257171_10675881 | 3300026377 | Soil | NQSAAANRRPAGQSDGSDNLSTIFAADRAFPAAVAELGR |
Ga0209648_101711021 | 3300026551 | Grasslands Soil | GAAANRRPAGPSAGSGNLSAIVAADRAFPAAVAELCR |
Ga0209577_100200267 | 3300026552 | Soil | MTTWPNQDAAANRRPAGQSDGSDNLSAIVAADRAFPGAVAELDR |
Ga0209286_10021236 | 3300027713 | Freshwater Sediment | MTMLWPNQSAAANRRPAGQSDGSGNLAAIVAADRAFPAAVAELGR |
(restricted) Ga0247836_11232081 | 3300027728 | Freshwater | LTPPNQSAAANRRPAGQLDGSGNLAATVAADRAFPAAVAEL |
Ga0209592_10221723 | 3300027731 | Freshwater Sediment | MTMLWPNQSAAANRRPAGQADGSGDLSAIVAADRAFPAAVAELGR |
Ga0209086_101344262 | 3300027770 | Freshwater Lake | MEMTTTWPNKGAAANRRPAGQLDGSDNLSATVAADRAFPAAVAELGR |
Ga0209107_100612051 | 3300027797 | Freshwater And Sediment | QSAAANRRPTGQLDGSDNLSATVAADRAFPAAVAELGR |
Ga0209814_102584413 | 3300027873 | Populus Rhizosphere | TLGGVAFQPNMTSNRRPAGQSDGSGNLSATLAANRASPAAVAELGR |
Ga0209777_106312572 | 3300027896 | Freshwater Lake Sediment | MVVTILWPNQGAAANRRPAGQSDGPGSLSVIVAADRAFPAAVAELGR |
Ga0209391_103013202 | 3300027975 | Freshwater Sediment | VMKMQANQSAAANRRPAGQSDGSGNLLATVAADRAFPAAVAELGRSA |
Ga0247719_10577762 | 3300028041 | Soil | MIEQANQSAAANRLPAGQSDGSDNLFATVAADRAFPAAVAELDRSTTRA |
Ga0137415_112664102 | 3300028536 | Vadose Zone Soil | MTLQTVMTNQGAAANRRPAGQFGGADNLSAIVAVDRAFPAAVAELGR |
Ga0265326_100159671 | 3300028558 | Rhizosphere | QPNKGAAANRRHAGQAGGSGNLPAIVAADRPFPAAVAELGR |
Ga0247823_103432032 | 3300028590 | Soil | MCIQGLKTRSNQSAAANRRPAGQLDGSGNLAATVAADRAFPAAVAELGR |
Ga0307277_103059512 | 3300028881 | Soil | AANRRTAGQSDGSDNLSAPLAAARAFPATVVELDH |
Ga0307513_108046792 | 3300031456 | Ectomycorrhiza | MPNQGAAANRRPAGQLDGSDNLSAIVAADRAFPAAVAELGR |
Ga0170819_129486131 | 3300031469 | Forest Soil | KKEAQPDGQSDGSGNLSATLAADRAFPAAVAELDR |
Ga0318541_102702961 | 3300031545 | Soil | MNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFAAAVAELDHWIIP |
Ga0318515_106658791 | 3300031572 | Soil | ESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELGR |
Ga0306917_104387673 | 3300031719 | Soil | MNESWPNKSAAANRRPAGQLDGAGNLSATVAADRAFAAAVAELDHWIIP |
Ga0307469_107152671 | 3300031720 | Hardwood Forest Soil | MVAGLIVAVSSHHKSAAANRRPALQSDGSDNLSATVAADRAFPAAVAELGR |
Ga0302321_1028788881 | 3300031726 | Fen | SRANNGAAANRRPAGQLAGSCNLAAIVTADRAFPAAFAGLDH |
Ga0306918_101364224 | 3300031744 | Soil | MNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAADAELDR |
Ga0318550_104181341 | 3300031797 | Soil | MNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAADA |
Ga0318523_104547032 | 3300031798 | Soil | MPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR |
Ga0315297_115929692 | 3300031873 | Sediment | MTPNQYAANRRPAGQSSGSDHLAAIVAADRAFPAAVAESGRWH |
Ga0306919_100428111 | 3300031879 | Soil | RVMNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAADAELDR |
Ga0306925_100799861 | 3300031890 | Soil | RVMNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR |
Ga0302322_1031571571 | 3300031902 | Fen | MLPNQRCSAAGQLDGSGNLAAIVAAARAFPAAVAELVVR |
Ga0306923_101659314 | 3300031910 | Soil | MNESWPNKGAAANRRPAGQLDGAGNLSATVAADRAFPAAVAELDR |
Ga0315910_107199292 | 3300032144 | Soil | MLSANQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVAEL |
Ga0315910_111434471 | 3300032144 | Soil | MLEQDAASNRRSAGQSDGSDNLEATLASNQAFPKAVAEYCR |
Ga0315910_111885651 | 3300032144 | Soil | EMTMTPNQSAAANRRPAGQSDGSGNLSAIVAADRAFPAAVAELDR |
Ga0315910_111885653 | 3300032144 | Soil | MTTWPNQSAAANRRPAGQLDGSRNLSATVAADRALPAAVAELD |
Ga0315910_114368451 | 3300032144 | Soil | MTMPNQSAAANRRPAGQLDGSGSLSAIVAADRAFPAAVAELGR |
Ga0315912_1001583711 | 3300032157 | Soil | MTQPNQSAAANRRPAGQLDGSGNLSAIVAADRAFPAAVAELGR |
Ga0315912_1001583714 | 3300032157 | Soil | MRAHTTRPNQSAPANRRPALQSDGLCNLAAIVAADRALPAAVAELGR |
Ga0315912_1001583716 | 3300032157 | Soil | MTPPNQSAAANRRPAGQPDGSGNLPAIVAADRAFPAAVAELGR |
Ga0315912_101294965 | 3300032157 | Soil | GIDMTWSNQSAAANRRPAGQLDGLGNLFATVAADRAFPAAVAELGR |
Ga0315912_102504342 | 3300032157 | Soil | MTWSNQSAAANRRPAGQFDGSGNLSATVAADRAFPAAVAELGR |
Ga0315912_109833752 | 3300032157 | Soil | MTEWLEANQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR |
Ga0315912_112274771 | 3300032157 | Soil | SAAANRRPAGQLDGSGNLFATVAADRAFPAAVAELGR |
Ga0315912_113585802 | 3300032157 | Soil | MTMLWPNQSAAANRRPAGQLDGSGNLFATVAADRAFPAAVVELGR |
Ga0315287_113871541 | 3300032397 | Sediment | MPSNQSAAANRRPAGQADGSGNLSAIVAADRTFPAAV |
Ga0335085_105302823 | 3300032770 | Soil | MKKMMKIGPSNQGVAANRRPAGQSDGSDNLSATLAADRAFPAAVAEL |
Ga0335082_114404392 | 3300032782 | Soil | MIRFCDCGPPNQGAAANRRPAGQSDGSENLSAIVAADRAFPAAVAELLRI |
Ga0335078_109856841 | 3300032805 | Soil | MSQSPNNGAAANRRHAGRSGGLGNLSAIIAADRAIPSEVAELDR |
Ga0335069_106898933 | 3300032893 | Soil | MKSGWSNQGAAANRRPAGQSDGSDNLSAIVAADRAFPAAVAELDR |
Ga0335071_114446611 | 3300032897 | Soil | MDGRELMPNQGAAANRRPAGQSDGSDNLSAIVAADRAFPAAVAEL |
Ga0335084_109494001 | 3300033004 | Soil | MMMPPDHSAAANRRPAGQASGSDNLLATLAADQAFAATVAERGRQARCGRAICHEH |
Ga0335084_110785481 | 3300033004 | Soil | MDSMTRHLTPNQGAAANRRPAGQSSGSDNLSATLAADRAFPAAVAELGSLCLKS |
Ga0316626_118608752 | 3300033485 | Soil | MVNQCAAAYRRPAGQPDGSGNLSAIVAADRAFPAAVAE |
Ga0316631_105197881 | 3300033493 | Soil | MKKPNQGAAANRRPAGQSDGSDSLTATVAADRAFPAAVAELCRSAA |
Ga0334985_0152535_835_963 | 3300034018 | Freshwater | MTPSQSAAANRRPTGQLDGSDNLSATVAADRAFPAAVAELGR |
Ga0335005_0019156_331_462 | 3300034022 | Freshwater | MPWSNKSAAANRRPAGQSDRSGNLSAIVAADRAFPAAVHALAT |
Ga0335000_0261100_875_1003 | 3300034063 | Freshwater | MTAKQITASNRRPARQSDCSGNFAAIVAADRTFPAAVAELGR |
Ga0335051_0080360_1554_1709 | 3300034109 | Freshwater | LVEILVMTTTRPNQRAVANRRPAGQFDGSGNLFATVAAGRAFPAAVALPNR |
Ga0370490_0003769_3482_3619 | 3300034128 | Untreated Peat Soil | MTWPNQSAAANRRPAGQSDGADNLAAIVAADRAFPAAVAELGRWA |
Ga0372943_0239756_578_715 | 3300034268 | Soil | MKESSPNKGAAANRRPAGQSDGSDDLSAIVAAGRAFPAAVAELDR |
⦗Top⦘ |