NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F010768

Metagenome / Metatranscriptome Family F010768

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010768
Family Type Metagenome / Metatranscriptome
Number of Sequences 299
Average Sequence Length 53 residues
Representative Sequence MKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP
Number of Associated Samples 251
Number of Associated Scaffolds 299

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 40.27 %
% of genes near scaffold ends (potentially truncated) 54.85 %
% of genes from short scaffolds (< 2000 bps) 97.99 %
Associated GOLD sequencing projects 239
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.656 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.435 % of family members)
Environment Ontology (ENVO) Unclassified
(55.518 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.572 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.18%    β-sheet: 0.00%    Coil/Unstructured: 62.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 299 Family Scaffolds
PF00115COX1 29.10
PF00033Cytochrome_B 2.34
PF00032Cytochrom_B_C 1.00
PF13631Cytochrom_B_N_2 0.33
PF13909zf-H2C2_5 0.33
PF00574CLP_protease 0.33
PF00587tRNA-synt_2b 0.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 299 Family Scaffolds
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 3.34
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.67
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 0.67
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.99 %
UnclassifiedrootN/A3.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10246268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae565Open in IMG/M
3300000425|P_2C_Liq_2_UnCtyDRAFT_1017504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1274Open in IMG/M
3300001589|JGI24005J15628_10123713All Organisms → cellular organisms → Eukaryota → Sar828Open in IMG/M
3300004786|Ga0007753_1015112All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300004790|Ga0007758_10124908All Organisms → cellular organisms → Eukaryota → Sar626Open in IMG/M
3300005516|Ga0066831_10178067All Organisms → cellular organisms → Eukaryota → Sar578Open in IMG/M
3300005596|Ga0066834_10128979All Organisms → cellular organisms → Eukaryota → Sar816Open in IMG/M
3300006025|Ga0075474_10154652All Organisms → cellular organisms → Eukaryota → Sar719Open in IMG/M
3300006121|Ga0007824_1079693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae619Open in IMG/M
3300006379|Ga0075513_1047677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae534Open in IMG/M
3300006383|Ga0075504_1068881All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300006397|Ga0075488_1067918All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300006403|Ga0075514_1043193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae651Open in IMG/M
3300006415|Ga0099654_10229806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae510Open in IMG/M
3300006705|Ga0031684_1016401All Organisms → cellular organisms → Eukaryota → Sar602Open in IMG/M
3300006706|Ga0005505_1228991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae537Open in IMG/M
3300006711|Ga0031673_1257104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae543Open in IMG/M
3300006720|Ga0031675_1274248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae546Open in IMG/M
3300006874|Ga0075475_10156424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium997Open in IMG/M
3300007519|Ga0105055_10247626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1701Open in IMG/M
3300007555|Ga0102817_1022398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1401Open in IMG/M
3300007557|Ga0102821_1190221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae523Open in IMG/M
3300007599|Ga0102780_1217399Not Available1643Open in IMG/M
3300007623|Ga0102948_1186110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae631Open in IMG/M
3300007655|Ga0102825_1009716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2002Open in IMG/M
3300007665|Ga0102908_1008673All Organisms → cellular organisms → Eukaryota → Sar1885Open in IMG/M
3300007667|Ga0102910_1164879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae524Open in IMG/M
3300007670|Ga0102862_1107718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium700Open in IMG/M
3300007756|Ga0105664_1074274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1492Open in IMG/M
3300007863|Ga0105744_1060999All Organisms → cellular organisms → Eukaryota → Sar929Open in IMG/M
3300008013|Ga0099809_11030989All Organisms → cellular organisms → Eukaryota → Sar579Open in IMG/M
3300008030|Ga0099821_1104775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a1379Open in IMG/M
3300008038|Ga0099805_1171094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a1339Open in IMG/M
3300008117|Ga0114351_1143506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1325Open in IMG/M
3300008674|Ga0103939_10515All Organisms → cellular organisms → Eukaryota → Sar679Open in IMG/M
3300008677|Ga0103937_10386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae594Open in IMG/M
3300008693|Ga0103943_10294All Organisms → cellular organisms → Eukaryota → Sar1089Open in IMG/M
3300008694|Ga0103929_1067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium963Open in IMG/M
3300008763|Ga0103912_10090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae700Open in IMG/M
3300008781|Ga0103596_10041Not Available1410Open in IMG/M
3300008832|Ga0103951_10127441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1137Open in IMG/M
3300008832|Ga0103951_10344272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae781Open in IMG/M
3300008832|Ga0103951_10607582All Organisms → cellular organisms → Eukaryota → Sar596Open in IMG/M
3300008834|Ga0103882_10065268All Organisms → cellular organisms → Eukaryota → Sar580Open in IMG/M
3300008849|Ga0103897_100175All Organisms → cellular organisms → Eukaryota → Sar800Open in IMG/M
3300008916|Ga0103481_1005161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae568Open in IMG/M
3300008929|Ga0103732_1054813All Organisms → cellular organisms → Eukaryota → Sar613Open in IMG/M
3300008931|Ga0103734_1022554All Organisms → cellular organisms → Eukaryota → Sar918Open in IMG/M
3300008933|Ga0103736_1049405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae552Open in IMG/M
3300008934|Ga0103737_1051893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae524Open in IMG/M
3300008935|Ga0103738_1015173All Organisms → cellular organisms → Eukaryota → Sar981Open in IMG/M
3300008935|Ga0103738_1044012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae624Open in IMG/M
3300008938|Ga0103741_1111431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae555Open in IMG/M
3300008999|Ga0102816_1309100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium504Open in IMG/M
3300009028|Ga0103708_100152172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae633Open in IMG/M
3300009055|Ga0102905_1091829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae624Open in IMG/M
3300009086|Ga0102812_10253436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae958Open in IMG/M
3300009130|Ga0118729_1126750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1191Open in IMG/M
3300009163|Ga0114970_10107344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1721Open in IMG/M
3300009172|Ga0114995_10672491All Organisms → cellular organisms → Eukaryota → Sar566Open in IMG/M
3300009179|Ga0115028_11068819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae654Open in IMG/M
3300009195|Ga0103743_1019749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae928Open in IMG/M
3300009195|Ga0103743_1026336All Organisms → cellular organisms → Eukaryota → Sar825Open in IMG/M
3300009195|Ga0103743_1072582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae517Open in IMG/M
3300009269|Ga0103876_1001870All Organisms → cellular organisms → Eukaryota → Sar1370Open in IMG/M
3300009279|Ga0103880_10040319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae637Open in IMG/M
3300009331|Ga0103824_101932All Organisms → cellular organisms → Eukaryota → Sar1200Open in IMG/M
3300009402|Ga0103742_1042343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae592Open in IMG/M
3300009422|Ga0114998_10331855All Organisms → cellular organisms → Eukaryota → Sar712Open in IMG/M
3300009432|Ga0115005_10754925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium782Open in IMG/M
3300009436|Ga0115008_10340720All Organisms → cellular organisms → Eukaryota → Sar1063Open in IMG/M
3300009436|Ga0115008_11372317All Organisms → cellular organisms → Eukaryota → Sar542Open in IMG/M
3300009438|Ga0115559_1064229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1524Open in IMG/M
3300009442|Ga0115563_1281444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae611Open in IMG/M
3300009443|Ga0115557_1174547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae855Open in IMG/M
3300009469|Ga0127401_1016801All Organisms → cellular organisms → Eukaryota2147Open in IMG/M
3300009481|Ga0114932_10084238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1991Open in IMG/M
3300009507|Ga0115572_10284501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae940Open in IMG/M
3300009537|Ga0129283_10347835All Organisms → cellular organisms → Eukaryota → Sar635Open in IMG/M
3300009543|Ga0115099_10817909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium628Open in IMG/M
3300009543|Ga0115099_11020561All Organisms → cellular organisms → Eukaryota → Sar567Open in IMG/M
3300009550|Ga0115013_11078732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae577Open in IMG/M
3300009550|Ga0115013_11507913All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300009592|Ga0115101_1311269All Organisms → cellular organisms → Eukaryota → Sar635Open in IMG/M
3300009599|Ga0115103_1813234All Organisms → cellular organisms → Eukaryota → Sar627Open in IMG/M
3300009606|Ga0115102_10219720All Organisms → cellular organisms → Eukaryota → Sar568Open in IMG/M
3300009677|Ga0115104_11135165All Organisms → cellular organisms → Eukaryota → Sar531Open in IMG/M
3300009679|Ga0115105_10606179Not Available1525Open in IMG/M
3300009705|Ga0115000_10821496All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300009722|Ga0123378_105087All Organisms → cellular organisms → Eukaryota → Sar962Open in IMG/M
3300009735|Ga0123377_1095381All Organisms → cellular organisms → Eukaryota → Sar652Open in IMG/M
3300009785|Ga0115001_10428814All Organisms → cellular organisms → Eukaryota → Sar823Open in IMG/M
3300009863|Ga0132187_104335All Organisms → cellular organisms → Eukaryota → Sar665Open in IMG/M
3300010014|Ga0133899_1000050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a2904Open in IMG/M
3300010033|Ga0126339_10332459All Organisms → cellular organisms → Eukaryota → Sar734Open in IMG/M
3300010034|Ga0126342_10444820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae539Open in IMG/M
3300010035|Ga0126343_10340563All Organisms → Viruses → Predicted Viral1033Open in IMG/M
3300010135|Ga0123382_1024985All Organisms → cellular organisms → Eukaryota → Sar518Open in IMG/M
3300010135|Ga0123382_1081531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300010316|Ga0136655_1126878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae765Open in IMG/M
3300010354|Ga0129333_10513245All Organisms → cellular organisms → Eukaryota → Sar1049Open in IMG/M
3300010404|Ga0129323_1038850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae969Open in IMG/M
3300010987|Ga0138324_10345285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae720Open in IMG/M
3300011012|Ga0150979_1116855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1339Open in IMG/M
3300011308|Ga0138393_1076387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium807Open in IMG/M
3300011325|Ga0138365_1200078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1439Open in IMG/M
3300012250|Ga0136573_105538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1347Open in IMG/M
3300012370|Ga0123369_1165497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1016Open in IMG/M
3300012523|Ga0129350_1296498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae826Open in IMG/M
3300012525|Ga0129353_1300459All Organisms → cellular organisms → Eukaryota → Sar613Open in IMG/M
3300012702|Ga0157596_1015137All Organisms → cellular organisms → Eukaryota → Sar523Open in IMG/M
3300012728|Ga0157552_1255174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae906Open in IMG/M
3300012756|Ga0138272_1062327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae875Open in IMG/M
3300012756|Ga0138272_1164782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Vinckeia) → Plasmodium yoelii2203Open in IMG/M
3300012760|Ga0138273_1188372Not Available1425Open in IMG/M
3300012763|Ga0138289_1169464Not Available1437Open in IMG/M
3300012763|Ga0138289_1183398All Organisms → cellular organisms → Eukaryota → Sar588Open in IMG/M
3300012763|Ga0138289_1183450All Organisms → cellular organisms → Eukaryota → Sar669Open in IMG/M
3300012765|Ga0138274_1019310All Organisms → cellular organisms → Eukaryota → Sar923Open in IMG/M
3300012772|Ga0138287_1120483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1219Open in IMG/M
3300012776|Ga0138275_1093741Not Available1672Open in IMG/M
3300012777|Ga0138292_1034089All Organisms → cellular organisms → Eukaryota → Sar766Open in IMG/M
3300012782|Ga0138268_1650099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales523Open in IMG/M
3300012954|Ga0163111_12089531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae571Open in IMG/M
3300012970|Ga0129338_1017215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae629Open in IMG/M
3300013010|Ga0129327_10868751All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
(restricted) 3300013137|Ga0172375_10147576All Organisms → cellular organisms → Eukaryota → Sar1920Open in IMG/M
3300013295|Ga0170791_10288395All Organisms → cellular organisms → Eukaryota → Sar553Open in IMG/M
3300013295|Ga0170791_11032776All Organisms → cellular organisms → Eukaryota → Sar619Open in IMG/M
3300013295|Ga0170791_12360910All Organisms → cellular organisms → Eukaryota → Sar816Open in IMG/M
3300013295|Ga0170791_14800209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1076Open in IMG/M
3300013295|Ga0170791_15506134All Organisms → cellular organisms → Eukaryota → Sar695Open in IMG/M
3300017377|Ga0186081_1048206All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300017772|Ga0181430_1198636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae573Open in IMG/M
3300018037|Ga0187883_10224871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae961Open in IMG/M
3300018521|Ga0193171_100238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1504Open in IMG/M
3300018526|Ga0193100_105369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae529Open in IMG/M
3300018594|Ga0193292_1000489All Organisms → cellular organisms → Eukaryota → Sar1436Open in IMG/M
3300018597|Ga0193035_1014598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium641Open in IMG/M
3300018617|Ga0193133_1022346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae545Open in IMG/M
3300018618|Ga0193204_1003585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1045Open in IMG/M
3300018633|Ga0188879_1005899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium967Open in IMG/M
3300018637|Ga0192914_1015732All Organisms → cellular organisms → Eukaryota → Sar583Open in IMG/M
3300018641|Ga0193142_1027489All Organisms → cellular organisms → Eukaryota → Sar816Open in IMG/M
3300018641|Ga0193142_1052354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae584Open in IMG/M
3300018655|Ga0192846_1031085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae563Open in IMG/M
3300018660|Ga0193130_1003956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1440Open in IMG/M
3300018660|Ga0193130_1018700All Organisms → cellular organisms → Eukaryota → Sar867Open in IMG/M
3300018660|Ga0193130_1019546All Organisms → cellular organisms → Eukaryota → Sar852Open in IMG/M
3300018690|Ga0192917_1061342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae555Open in IMG/M
3300018699|Ga0193195_1007516All Organisms → cellular organisms → Eukaryota → Sar1028Open in IMG/M
3300018723|Ga0193038_1023678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae917Open in IMG/M
3300018723|Ga0193038_1023680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae917Open in IMG/M
3300018743|Ga0193425_1019830All Organisms → cellular organisms → Eukaryota → Sar873Open in IMG/M
3300018747|Ga0193147_1070900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae578Open in IMG/M
3300018747|Ga0193147_1070901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae578Open in IMG/M
3300018765|Ga0193031_1013806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1088Open in IMG/M
3300018765|Ga0193031_1040235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae760Open in IMG/M
3300018765|Ga0193031_1040238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae760Open in IMG/M
3300018767|Ga0193212_1024129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae869Open in IMG/M
3300018767|Ga0193212_1024130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae869Open in IMG/M
3300018767|Ga0193212_1025462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae849Open in IMG/M
3300018767|Ga0193212_1066152All Organisms → cellular organisms → Eukaryota → Sar543Open in IMG/M
3300018769|Ga0193478_1034305All Organisms → cellular organisms → Eukaryota → Sar813Open in IMG/M
3300018775|Ga0188848_1006538All Organisms → cellular organisms → Eukaryota → Sar1306Open in IMG/M
3300018780|Ga0193472_1031493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae582Open in IMG/M
3300018791|Ga0192950_1077473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium501Open in IMG/M
3300018811|Ga0193183_1077300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae595Open in IMG/M
3300018813|Ga0192872_1076125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium579Open in IMG/M
3300018820|Ga0193172_1023004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1020Open in IMG/M
3300018846|Ga0193253_1095224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae700Open in IMG/M
3300018850|Ga0193273_1058176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae578Open in IMG/M
3300018855|Ga0193475_1060486All Organisms → cellular organisms → Eukaryota → Sar609Open in IMG/M
3300018873|Ga0193553_1136596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae576Open in IMG/M
3300018930|Ga0192955_10173731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae555Open in IMG/M
3300018934|Ga0193552_10048468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1081Open in IMG/M
3300018934|Ga0193552_10048470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1081Open in IMG/M
3300018934|Ga0193552_10053477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1042Open in IMG/M
3300018934|Ga0193552_10053478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1042Open in IMG/M
3300018934|Ga0193552_10053479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1042Open in IMG/M
3300018947|Ga0193066_10209817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae553Open in IMG/M
3300018947|Ga0193066_10209822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae553Open in IMG/M
3300018980|Ga0192961_10177190All Organisms → cellular organisms → Eukaryota → Sar645Open in IMG/M
3300018982|Ga0192947_10221000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae617Open in IMG/M
3300018982|Ga0192947_10226767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae607Open in IMG/M
3300018982|Ga0192947_10226768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae607Open in IMG/M
3300018983|Ga0193017_10131604All Organisms → cellular organisms → Eukaryota → Sar838Open in IMG/M
3300018983|Ga0193017_10131605All Organisms → cellular organisms → Eukaryota → Sar838Open in IMG/M
3300018983|Ga0193017_10131606All Organisms → cellular organisms → Eukaryota → Sar838Open in IMG/M
3300018983|Ga0193017_10133394All Organisms → cellular organisms → Eukaryota → Sar831Open in IMG/M
3300018989|Ga0193030_10069368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1011Open in IMG/M
3300018989|Ga0193030_10143253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae769Open in IMG/M
3300019001|Ga0193034_10163170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae546Open in IMG/M
3300019006|Ga0193154_10311800All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300019031|Ga0193516_10219174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium626Open in IMG/M
3300019036|Ga0192945_10011245All Organisms → cellular organisms → Eukaryota → Sar1813Open in IMG/M
3300019036|Ga0192945_10216850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae611Open in IMG/M
3300019037|Ga0192886_10208537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae629Open in IMG/M
3300019039|Ga0193123_10393439All Organisms → cellular organisms → Eukaryota → Sar542Open in IMG/M
3300019043|Ga0192998_10281066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae511Open in IMG/M
3300019045|Ga0193336_10477563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae595Open in IMG/M
3300019046|Ga0193546_10057034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae533Open in IMG/M
3300019047|Ga0193549_10043267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae580Open in IMG/M
3300019047|Ga0193549_10048067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae553Open in IMG/M
3300019047|Ga0193549_10053293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae527Open in IMG/M
3300019053|Ga0193356_10233815All Organisms → cellular organisms → Eukaryota → Sar648Open in IMG/M
3300019053|Ga0193356_10254393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae619Open in IMG/M
3300019053|Ga0193356_10259698All Organisms → cellular organisms → Eukaryota → Sar612Open in IMG/M
3300019094|Ga0193040_1012902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae591Open in IMG/M
3300019100|Ga0193045_1056864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae620Open in IMG/M
3300019103|Ga0192946_1010358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1295Open in IMG/M
3300019103|Ga0192946_1010362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1295Open in IMG/M
3300019117|Ga0193054_1067881All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300019118|Ga0193157_1034883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae526Open in IMG/M
3300019749|Ga0193983_1029604All Organisms → cellular organisms → Eukaryota → Sar734Open in IMG/M
3300020166|Ga0206128_1056310All Organisms → cellular organisms → Eukaryota → Sar1878Open in IMG/M
3300020214|Ga0194132_10112438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1708Open in IMG/M
3300020436|Ga0211708_10099580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a1137Open in IMG/M
3300020455|Ga0211664_10136444All Organisms → cellular organisms → Eukaryota → Sar1148Open in IMG/M
3300020560|Ga0208852_1070882Not Available545Open in IMG/M
3300021089|Ga0206679_10552943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium594Open in IMG/M
3300021108|Ga0214162_1049922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae699Open in IMG/M
3300021131|Ga0214206_1024415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae724Open in IMG/M
3300021323|Ga0210295_1005050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae678Open in IMG/M
3300021348|Ga0206695_1268859All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300021350|Ga0206692_1250725All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300021350|Ga0206692_1470148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae590Open in IMG/M
3300021378|Ga0213861_10450225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae621Open in IMG/M
3300021442|Ga0206685_10133745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae827Open in IMG/M
3300021887|Ga0063105_1046777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1143Open in IMG/M
3300021934|Ga0063139_1047704All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300021942|Ga0063098_1088063All Organisms → cellular organisms → Eukaryota → Sar554Open in IMG/M
3300021961|Ga0222714_10616549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae540Open in IMG/M
3300022227|Ga0187827_10604505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae639Open in IMG/M
3300022848|Ga0222674_1071131All Organisms → cellular organisms → Eukaryota → Sar548Open in IMG/M
3300022885|Ga0222662_1017119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a1735Open in IMG/M
3300023230|Ga0222709_1044554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae575Open in IMG/M
3300023555|Ga0232120_103681All Organisms → cellular organisms → Eukaryota → Sar764Open in IMG/M
3300023676|Ga0232114_133359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300023702|Ga0232119_1024899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae928Open in IMG/M
(restricted) 3300024059|Ga0255040_10411622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae574Open in IMG/M
3300024244|Ga0228678_1019041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1255Open in IMG/M
3300024294|Ga0228664_1040543All Organisms → cellular organisms → Eukaryota → Sar1178Open in IMG/M
3300025641|Ga0209833_1092974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium889Open in IMG/M
3300025849|Ga0209603_1090664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1400Open in IMG/M
3300026123|Ga0209955_1021144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1489Open in IMG/M
3300026400|Ga0247573_1051995All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300026406|Ga0247565_1062890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae512Open in IMG/M
3300026426|Ga0247570_1095337All Organisms → cellular organisms → Eukaryota → Sar565Open in IMG/M
3300026437|Ga0247577_1017168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1539Open in IMG/M
3300026460|Ga0247604_1114297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Vinckeia) → Plasmodium yoelii602Open in IMG/M
3300026468|Ga0247603_1139116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae503Open in IMG/M
3300026500|Ga0247592_1140395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae577Open in IMG/M
3300026919|Ga0209892_1015965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae517Open in IMG/M
3300027103|Ga0255581_1054456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1327Open in IMG/M
3300027103|Ga0255581_1139829All Organisms → cellular organisms → Eukaryota → Sar651Open in IMG/M
3300027186|Ga0208797_1035955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae640Open in IMG/M
3300027210|Ga0208802_1049883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium567Open in IMG/M
3300027675|Ga0209077_1137441All Organisms → cellular organisms → Eukaryota → Sar682Open in IMG/M
3300027752|Ga0209192_10086221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1323Open in IMG/M
3300027752|Ga0209192_10226911All Organisms → cellular organisms → Eukaryota → Sar700Open in IMG/M
3300027769|Ga0209770_10124141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1052Open in IMG/M
3300027771|Ga0209279_10069120All Organisms → cellular organisms → Eukaryota → Sar1000Open in IMG/M
3300027771|Ga0209279_10107427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae800Open in IMG/M
3300027805|Ga0209229_10319680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae682Open in IMG/M
3300027836|Ga0209230_10398795All Organisms → cellular organisms → Eukaryota → Sar788Open in IMG/M
3300027849|Ga0209712_10606371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium608Open in IMG/M
3300027859|Ga0209503_10592485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae553Open in IMG/M
(restricted) 3300027861|Ga0233415_10018096All Organisms → cellular organisms → Eukaryota → Sar2790Open in IMG/M
3300027890|Ga0209496_10606624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae592Open in IMG/M
3300028088|Ga0255251_1073080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae661Open in IMG/M
3300028106|Ga0247596_1125914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae582Open in IMG/M
3300028124|Ga0228621_1082619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae500Open in IMG/M
3300028598|Ga0265306_10673869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae571Open in IMG/M
3300030653|Ga0307402_10208087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1090Open in IMG/M
3300030670|Ga0307401_10389034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae634Open in IMG/M
3300030671|Ga0307403_10572384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae612Open in IMG/M
3300030699|Ga0307398_10696503All Organisms → cellular organisms → Eukaryota → Sar563Open in IMG/M
3300030709|Ga0307400_10532413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae740Open in IMG/M
3300030721|Ga0308133_1044457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium599Open in IMG/M
3300030725|Ga0308128_1021862All Organisms → cellular organisms → Eukaryota → Sar757Open in IMG/M
3300030780|Ga0073988_10015753All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300030788|Ga0073964_10022171All Organisms → cellular organisms → Eukaryota → Sar823Open in IMG/M
3300030871|Ga0151494_1122940All Organisms → cellular organisms → Eukaryota → Sar704Open in IMG/M
3300030956|Ga0073944_10004349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae669Open in IMG/M
3300030956|Ga0073944_11436348All Organisms → cellular organisms → Eukaryota → Sar644Open in IMG/M
3300031222|Ga0307972_1188583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae610Open in IMG/M
3300031539|Ga0307380_10773487All Organisms → cellular organisms → Eukaryota → Sar797Open in IMG/M
3300031550|Ga0307392_1048092All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300031556|Ga0308142_1043623All Organisms → cellular organisms → Eukaryota → Sar665Open in IMG/M
3300031579|Ga0308134_1127021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae586Open in IMG/M
3300031596|Ga0302134_10243920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium706Open in IMG/M
3300031710|Ga0307386_10327967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae775Open in IMG/M
3300031750|Ga0307389_10494568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae783Open in IMG/M
3300033995|Ga0335003_0432219All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300034022|Ga0335005_0121889Not Available1681Open in IMG/M
3300034060|Ga0334983_0695924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium541Open in IMG/M
3300034481|Ga0315299_26114All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.43%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.68%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica3.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.01%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.01%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral2.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.67%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.67%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.34%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.34%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.34%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water1.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.67%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.67%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.67%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.67%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.67%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.67%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.67%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.67%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.33%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.33%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.33%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.33%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.33%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.33%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.33%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.33%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.33%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.33%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.33%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.33%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.33%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.33%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.33%
MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Marine0.33%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.33%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.33%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.33%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.33%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.33%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.33%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.33%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.33%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.33%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.33%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.33%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000425Marine microbial community from Union City, CA, USA - Pond 2C Liquid 2EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004786Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005596Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43BEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006121Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006705Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP547 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006706Marine microbial communities from the Deep Indian Ocean - MP0958 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006711Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2255 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006720Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2618 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007599Marine microbial communities from the Southern Atlantic ocean - KN S15 DCM_A metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007756Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008013Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008030Coral microbial communities from Puerto Morelos, Mexico - Siderastrea T C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008038Coral microbial communities from Puerto Morelos, Mexico - Orbicella C B metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008674Planktonic microbial communities from coastal waters of California, USA - Canon-45EnvironmentalOpen in IMG/M
3300008677Planktonic microbial communities from coastal waters of California, USA - Canon-43EnvironmentalOpen in IMG/M
3300008693Planktonic microbial communities from coastal waters of California, USA - Canon-50EnvironmentalOpen in IMG/M
3300008694Planktonic microbial communities from coastal waters of California, USA - Canon-31EnvironmentalOpen in IMG/M
3300008763Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3041EnvironmentalOpen in IMG/M
3300008781Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micronEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008849Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2023EnvironmentalOpen in IMG/M
3300008916Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA2EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009331Microbial communities of water from the North Atlantic ocean - ACM11EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009722Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_241_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009863Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010014Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample H2Host-AssociatedOpen in IMG/M
3300010033Coral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella T R C metagenomeHost-AssociatedOpen in IMG/M
3300010034Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 1 metagenomeHost-AssociatedOpen in IMG/M
3300010035Coral microbial communities from Lord Howe Island, Old Settlement Bay, Australia - Cyphastrea 2 metagenomeHost-AssociatedOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011012Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPsEnvironmentalOpen in IMG/M
3300011308Marine microbial communities from the Southern Atlantic ocean - KN S18 NT29 metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011325Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012250Saline lake microbial communities from Deep lake, Antarctica - Metagenome #85EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012702Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012728Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012765Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012776Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012777Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017377Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, low P, at 24 C, 32 psu salinity and 234 ?mol photons light - Alexandrium monilatum CCMP 3105 (MMETSP0096)Host-AssociatedOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018526Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018633Metatranscriptome of marine microbial communities from Baltic Sea - GS857_ls5EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018775Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019046Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408503-ERR1336911)EnvironmentalOpen in IMG/M
3300019047Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399746-ERR1328125)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020455Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022227Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022848Saline water microbial communities from Ace Lake, Antarctica - #866EnvironmentalOpen in IMG/M
3300022885Saline water microbial communities from Ace Lake, Antarctica - #600EnvironmentalOpen in IMG/M
3300023230Saline water microbial communities from Ace Lake, Antarctica - #1692EnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023702Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300025641Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026400Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 26R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026406Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 13R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026426Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026919Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027103APAL control metatranscriptome co-assemblyHost-AssociatedOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027210Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028088Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031222Saline water microbial communities from Organic Lake, Antarctica - #780EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034481Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_Tmax_1102 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1024626813300000101MarineLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
P_2C_Liq_2_UnCtyDRAFT_101750433300000425EnviromentalMKEVLNGGYNVHPVPPPNSENKERITKRYERERIKIEKLFTLGYTTSGDP*
JGI24005J15628_1012371313300001589MarineMKEVLNGGYNVHPVPPPNSEIKEXIXKRYERERIKIEKLFTLGYTTSGDP*
Ga0007753_101511213300004786Freshwater LakeVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIKKRYETKRIKIEKLLTLGYTTSGDP*
Ga0007758_1012490823300004790Freshwater LakeLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP*
Ga0066831_1017806723300005516MarineMYVVEDGDKLMKDVLNGGYNVHPVPPPNSAIKERSMTINEKTSRKIEKLLALG*
Ga0066834_1012897923300005596MarineMKEVVNGGYNVQPIPAPNSEIKERMIKRYERERIKIEKLFTLGYTTSGDP*KIGTK*
Ga0075474_1015465223300006025AqueousMKAVLEGDKLMKEVLNGGYNVHPVPPPKSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0007824_107969323300006121FreshwaterKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0075513_104767713300006379AqueousVLEGDKLMKEVLNGGYNVHPVPPPKSEIKERIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0075504_106888123300006383AqueousMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRIKIERLFTLGYTTSGDP*KIGAK*
Ga0075488_106791823300006397AqueousMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRTKIERLFTLGYTTSGDP*
Ga0075514_104319313300006403AqueousMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP*KIGAK*
Ga0099654_1022980613300006415LakeMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*
Ga0031684_101640113300006705Deep OceanMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRIKIERLFTLGYTTSGDP*
Ga0005505_122899113300006706Deep OceanLEGDKLMKEVLNGGYNVHPVPPPNSETKERITRRYERKRIKIEKLFTLGYTTSGDP*
Ga0031673_125710413300006711Deep OceanMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRTKIERLFTLGYTTSGDP*KIGAK*
Ga0031675_127424823300006720Deep OceanMPDINSPQITNAILEGARTMCEVLRGGYIVHPDPPPNSVITERIRSIYERNKINIEKLFILG
Ga0075475_1015642423300006874AqueousMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEMKERITKRYETERIKIEKLFTLGYTTSGDP
Ga0105055_1024762613300007519FreshwaterMNEVDNGGYNVHPVPLPNSEIKESIRKRYERNRINIEKLLTLGYTTSGDP*
Ga0102817_102239833300007555EstuarineMKEVLNGGYNVHPVPAPNSENKERITKRYERERIKIEKLFTLG
Ga0102821_119022113300007557EstuarineAVLEGDKLMKEVLNGGYNVHPVPAPNSENKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0102780_121739923300007599MarineMKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFILGYTTSGDP*
Ga0102948_118611023300007623WaterMKEVLNGGYNVHPVPPPNSEIKESIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0102825_100971613300007655EstuarineMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*
Ga0102908_100867313300007665EstuarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTL
Ga0102910_116487913300007667EstuarineKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0102862_110771823300007670EstuarineMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDP*
Ga0105664_107427423300007756Background SeawaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLLTLGYTTSGDP*
Ga0105744_106099913300007863Estuary WaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0099809_1103098913300008013CoralMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIERLLTLGYTTSGDP*
Ga0099821_110477523300008030CoralVDNGGRSVHPVPPPNSEIIERIRKRYESKRTKIEKLLTLGYTTSGDP*
Ga0099805_117109413300008038CoralVDNGGKSVHPVPPPNSEIIERIRKRYESKRTKIEKLLTLGYTTSGDP*
Ga0114351_114350613300008117Freshwater, PlanktonMKEVDNGGYNVHPVPPPNSEIKERIRKRYESERIKIEKLLTLGYTTSGDP*
Ga0103939_1051523300008674Coastal WaterMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRIKIEKLFTLGYTTSGDP*
Ga0103937_1038623300008677Coastal WaterMKEVLNGGYNVHPVPPPNSETKERSARKYERKRIKIEKLFTLGYTTSGDP*
Ga0103943_1029413300008693Coastal WaterMKEVLNGGYNVHPVPPPNSEIKERIAKKYERKKTKIEKLFTLGYTTSGGP
Ga0103929_106733300008694Coastal WaterMKEVLNGGYNVHPVPPPNSETKERSARKYERKRTKIEKLFTLGYTTS
Ga0103912_1009023300008763Surface Ocean WaterMKEVLNGGYNVHPVPPPNSETKERSTRRYERKRTKIEKLFTLGYTTSGDP*
Ga0103596_1004113300008781Ocean WaterMKEVLNGGYNVHPVPPPNSETKERAARKYERKRSKTEKLFTLGYTTSGDPKKTGAK*
Ga0103951_1012744113300008832MarineMRATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0103951_1034427213300008832MarineMKATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRSKIERLLTLGYTTSGDP
Ga0103951_1060758223300008832MarineYNVHPVPPPNSEIKERIRRRYERKRIKIERLLTLGYTTSGDP*
Ga0103882_1006526823300008834Surface Ocean WaterMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTRGYTTSGDP*
Ga0103897_10017523300008849Surface Ocean WaterMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRIKIEKLFTLGYTTSGDP*
Ga0103481_100516113300008916Bay WaterMKEVLNGGYNVHPVPAPNSETKERTTKTTERKRSKMEKLFTLGY
Ga0103732_105481323300008929Ice Edge, Mcmurdo Sound, AntarcticaMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERSAKRYERKRSKIEKLFIFHF*
Ga0103734_102255413300008931Ice Edge, Mcmurdo Sound, AntarcticaMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP*
Ga0103736_104940523300008933Ice Edge, Mcmurdo Sound, AntarcticaGGYNVHPVPPPNSETKERSARKYERKRIKIEKLFTLGYTTSGDP*
Ga0103737_105189323300008934Ice Edge, Mcmurdo Sound, AntarcticaGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP*
Ga0103738_101517323300008935Ice Edge, Mcmurdo Sound, AntarcticaEVLNGGYNVHPVPPPNSETREMITRKYEREKTKIERLFSLGYTTSGDP*
Ga0103738_104401213300008935Ice Edge, Mcmurdo Sound, AntarcticaEVLNGGYNVHPVPPPNSETKERSARKYERKRIKIEKLFTLGYTTSGDP*
Ga0103741_111143123300008938Ice Edge, Mcmurdo Sound, AntarcticaMKEVLNGGYNVQPTPPPNSEIKERITRRYERKRIKIEKLFTLGYTT
Ga0102816_130910013300008999EstuarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKITERKRIKMEKLFTLGYTTS
Ga0103708_10015217213300009028Ocean WaterVVEGDKLMKEVLNGGYNVHPVPPPNSENKERIMKRYERERIKMEKLFTLGYTTSGDP*
Ga0102905_109182923300009055EstuarineVLNGGYNVHPVPPPNSENKERITKRYERERIKIEKL
Ga0102812_1025343613300009086EstuarineNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*
Ga0118729_112675013300009130MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDP*
Ga0114970_1010734423300009163Freshwater LakeMKEVDRGGYNVHPVPPPNSEIKERISKRYESKRIKIEKLLTLGYTTSGDP*
Ga0114995_1067249113300009172MarineMKEVVNGGYNVHPVPPPNSEIKEKIMKRYERERIKIEKLLTLGYTTSGEP*
Ga0115028_1106881913300009179WetlandMKLVLNGGYNVHPVPPPNSDIKESIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0103743_101974913300009195Ice Edge, Mcmurdo Sound, AntarcticaMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP*
Ga0103743_102633623300009195Ice Edge, Mcmurdo Sound, AntarcticaMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP*
Ga0103743_107258223300009195Ice Edge, Mcmurdo Sound, AntarcticaGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP*
Ga0103876_100187023300009269Surface Ocean WaterMKEVLNGGYNVHPVPPPNSEIKERIKKRYERKRIKIEKLLTLGYTTSGDP*
Ga0103880_1004031923300009279Surface Ocean WaterMKEVLNGGYNVHPVPPPNSEIEERTKKRYERKRTKIEK
Ga0103824_10193213300009331River WaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRSKIEKLFTLGYTTSGDP*
Ga0103742_104234313300009402Ice Edge, Mcmurdo Sound, AntarcticaNVHPVPPPNSEIKERITKRYERKRIKIERLLTLGYTTSGDP*
Ga0114998_1033185513300009422MarineIKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDP*
Ga0115005_1075492513300009432MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDPCKIGTK*
Ga0115008_1034072013300009436MarineMKEVLNGGYNVHPVPAPNSEIKERIRKRYERQRIKIEKLFTLGYTTSGDP*
Ga0115008_1137231713300009436MarineYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGE*
Ga0115559_106422913300009438Pelagic MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSKIKERITKRYERERIKIEKLFTLGYTTSGDP
Ga0115563_128144423300009442Pelagic MarineGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0115557_117454713300009443Pelagic MarineAVVEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0127401_101680163300009469Meromictic PondMKEVLNGGYNVHPVPAPNSENKERITKRYERERVKIEKLFTTNT*
Ga0114932_1008423813300009481Deep SubsurfaceMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIMIEKLFTLGYTTSGDPCKIGTK*
Ga0115572_1028450113300009507Pelagic MarineGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0129283_1034783513300009537Beach Aquifer PorewaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEILFTLGSTSYEN*
Ga0115099_1081790923300009543MarineMRATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRTKIEKLFTLGYTTSGDPCKTGAK*
Ga0115099_1102056113300009543MarineMKEVLNGGYNVHPVPPPNSETKERIAKKYERKKTKIEKLFTLGYTTSGDP*
Ga0115013_1107873213300009550MarineMKELLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLLILEKD*
Ga0115013_1150791323300009550MarineMKEVLNGGYNVHPVPTPNSEIKERTDKRYESERIKIEKLFTLGYTTSGDP*
Ga0115101_131126923300009592MarineMKEVLNGGYNVHPVPAPNSEINERIRRRYERNRIKIERLLTLGYTTSGDP*
Ga0115103_181323423300009599MarineYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDTNNEEEIFSII*
Ga0115102_1021972023300009606MarineMKEVVNGGYNVHPVPPPNSEIKEKITRRYERKRIKIEKLLTLGYTTSGEP*
Ga0115104_1113516513300009677MarineYNVHPVPPPNSEIKEKIARRYERKRIKIEKLLTLGYTTSGDP*
Ga0115105_1060617923300009679MarineMNAMLEGAKTMCEVLSGGYIVQPEPPPNSQITERIRRRYERKSIKIEKLFILGYTTSGDP
Ga0115000_1082149613300009705MarineVLKGGYNVHPVPPPNSVPKESITKRYEIGRRKIDKLLTLGYTTSADPRKIGTK*
Ga0123378_10508723300009722MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYEGERIKIEKLFTLGYTTS
Ga0123377_109538123300009735MarineMKEVDNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*
Ga0115001_1042881413300009785MarineLIKEVLKGGYNVHPVPPPNSVPKESITKRYEIGRRKIDKLLTLGYTTSADPRKIGTK*
Ga0132187_10433513300009863Meromictic PondGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP*
Ga0133899_100005023300010014Host-AssociatedVDNGGKNVHPVPPPNSEIIERIRKRYESKRIKIEKLLTLGYTTSGDP*
Ga0126339_1033245913300010033CoralMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLLTLGYTTS
Ga0126342_1044482013300010034CoralECDKVMKEVVNGGYNVHPVPPPNSEIKDRIRKRYERERIKIEKLFTLGYTTSEDPWKIGRK*
Ga0126343_1034056313300010035CoralMKEVVNGGYNVHPVPPPNSEIKDRIRKRYERERIKIEKLFTLGYTTSEDPWKIGRK*
Ga0123382_102498513300010135MarineMKEVLNGGYNVHPVPPPNSEIKERIAKKYERKKTKTEKLFTLGYTTSGDP*
Ga0123382_108153123300010135MarineGYNVHPVPPPNSEMRERITRRYERERIMIEKLFSLGYTTSGDP*
Ga0136655_112687813300010316Freshwater To Marine Saline GradientVVEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0129333_1051324513300010354Freshwater To Marine Saline GradientVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLG*
Ga0129323_103885023300010404AqueousMKEVLNGGYNVHPVPPPNSEIKERIAKKYERKKIKTEKLFTLGYTTSGDP*
Ga0138324_1034528513300010987MarineKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP*
Ga0150979_111685513300011012MarineMKEVVNGGYNVHPVPPPNSEIKEKIMRRYERKRIKIEKLLTLGYTTSGEP*
Ga0138393_107638723300011308MarineMRATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRIKIEKLLTLGYTTSGEP
Ga0138365_120007823300011325MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRTKIEKLFTLGYTTSGDPCKTGAK*
Ga0136573_10553813300012250Saline LakeMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSPDP*
Ga0123369_116549723300012370MarineEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRIKIEKLFTLGYTTSGDP*
Ga0129350_129649823300012523AqueousMKEVLNGGYNVHPVPPPNSEIKERSAKKYERKRTKIEKLFTLGYTTSGDP*
Ga0129353_130045913300012525AqueousMKEVLNGGYNVHPVPPPNSETKERSARKYERKRTKIEKLFTLGYTTSGDP*
Ga0157596_101513713300012702FreshwaterMKEVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLLTLGYTTSGDP*
Ga0157552_125517423300012728FreshwaterMKDVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLFTLGYTTSGDP*
Ga0138272_106232713300012756Freshwater LakeLEGDNDMKEVDNGGYNVHPVPPPNSDINESIMKRYESKSIKIEKLLTLGYTTSEEP*
Ga0138272_116478223300012756Freshwater LakeMNEVDNGGYNVHPVPPPNSEIKDRISIIYDRKRIKIEKLLTLGYTTSGDP*
Ga0138273_118837223300012760Freshwater LakeVLEGDIDMKDVDSGGYKVHPVPPPNSEIKESIRKRYETKRIKIEKLLILGNTTSGDP*
Ga0138289_116946423300012763Freshwater LakeMNEVDRGGYNVHPVPPPNSITIDNIKIRYENKRINIEKLLTLG*
Ga0138289_118339813300012763Freshwater LakeMKEVDNGGYNVHPVPLPNSEIKERISKRYESKRIKIEKLLTLGYTTSGDP*
Ga0138289_118345023300012763Freshwater LakeMKEVDNGGYNVHPVPPPNSEIKERIKKRYERRRIKIEKLLTRGYTTSGDP*
Ga0138274_101931023300012765Freshwater LakeMKEVDNGGYNVHPVPPPNSEINDRIRKRYESKRIKIEKLLTLGYTTSGDP*
Ga0138287_112048333300012772Freshwater LakeMKEVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLLTLGYTTSGDA*
Ga0138275_109374123300012776Freshwater LakeMNEVDRGGYNVHPVPPPNSITIDNIKIRYENKRINIEKLFTLG*
Ga0138292_103408923300012777Freshwater LakeMKEVDNGGYNVHPVPPPNSEIKERIMKRYERKRIKIEKLLTLGYTTSGDP*
Ga0138268_165009913300012782Polar MarineKNMKEELNGGYNVHHVPPPKSETKEKSARKYERKRIKIEKLFTLGYTTS*
Ga0163111_1208953113300012954Surface SeawaterAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*
Ga0129338_101721513300012970AqueousNNPKIRFPVLEGDKVMKEVDNGGYNVHPVPPPNSEIKERIRKRYESKRTKIEKLLTLG*
Ga0129327_1086875123300013010Freshwater To Marine Saline GradientMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSPDP
(restricted) Ga0172375_1014757623300013137FreshwaterMIDKLMKLVLNGGYNVHPVPPPNSEIKESIRKRYERERIKIEKLLTLGYTTSGDP*
Ga0170791_1028839513300013295FreshwaterMKDVDNGGYNVHPVPPPNSEIKERISKRYERKRIKMEKLFTLGYTTSGDP*
Ga0170791_1103277623300013295FreshwaterMKEVDNGGYNVHPVPPPNSEIKERIKKRYERKRIKIEKLFTLGYTTSGDP*
Ga0170791_1236091013300013295FreshwaterMKEVDNGGYNVHPVPPPNSEIKDRIKKRYESKRIKIEKLLTLGYTTSGDP*
Ga0170791_1480020923300013295FreshwaterMKEVDNGGYNVHPVPPPNSEIKERIRKRYDRRRIKIEKLLTLGYTTSGDP*
Ga0170791_1550613413300013295FreshwaterMNEVDNGGYNVHPTPGPNSDIKEIIKKRYEMKRIKIEKLFTLG*
Ga0186081_104820613300017377Host-AssociatedEGDKLMKEVLNGGYNVHPVPPPNSEIKERIMKRYETKRIEIEKLLTLGYTTSGDP
Ga0181430_119863613300017772SeawaterYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0187883_1022487113300018037PeatlandDKLMKEVLNGGYNVHPVPPPNSEIKEKIRKRYERERIKIEKLLTLGYTTSGDP
Ga0193171_10023823300018521MarineMKEVVNGGYNVHPVPPPNSEIKDRIRKRYERERIKIERLFTLGYTTSGDPWKIGRK
Ga0193100_10536913300018526MarineDKLMKEVLNGGYNVHPVPDPNSEIKERIRRKYERQRTKIEKLLTLGYTTSGEP
Ga0193292_100048933300018594MarineMLAVETLIKEVLKGGYNVHPVPPPKSQIIERIIIRYERKRIKMEKLLILG
Ga0193035_101459813300018597MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRTRIEKLFTLGYTP
Ga0193133_102234613300018617MarineVLNGGYNVHPVPPPNSEIKERIRKRYEGKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0193204_100358513300018618MarineMKATLEGDKLMKEVLNGGYNVHPVPPPNSETREKIMRKYERKRTEIEKLFILGYTTSGDP
Ga0188879_100589923300018633Freshwater LakeMKAILEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRTKIEKLLTLGYTTSGDP
Ga0192914_101573213300018637MarineMKEVLNGGYNVHPVPPPKAEIKENITRKYERKRIKIERLFTLGYTTSGDP
Ga0193142_102748913300018641MarineMKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0193142_105235413300018641MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP
Ga0192846_103108513300018655MarineLEGDKLMKEVLNGGYNVHPVPAPNSETKERTTKTTERKRSKMEKLFTLGYTTSGDP
Ga0193130_100395613300018660MarineMLAVETLIKEVLKGGYNVHPVPPPKSQMIERIIIRYERKRIKMEKLLILG
Ga0193130_101870023300018660MarineMKEVLNGGYNVHPVPDPNSEIKERIRRKYERQRTKIEKLLTLGYTTSGEPXKIGTK
Ga0193130_101954623300018660MarineMKEVLNGGYNVHPVPDPNSEIKERIRRKYERQRTKIEKLLTLGYTTSGEP
Ga0192917_106134213300018690MarineVLNGGYNVHPVPPPNSEIEERIKKRYERKRTKIEKLLTLGYTTSGDPRKTGAK
Ga0193195_100751623300018699MarineMKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFILGYTTSGDPXKIGAK
Ga0193038_102367813300018723MarineMKEVLNGGYNVHPVPPPNSEIKERIVKRYERKRTKIEKLLALGYTTSGDP
Ga0193038_102368013300018723MarineMKEVLNGGYNVHPVPPPNSEIKESITRRYERKRIKIEKLFTLGYTTSGDPXKIGAK
Ga0193425_101983013300018743MarineMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDPXKIGAK
Ga0193147_107090013300018747MarineDKLMKEVLNGGYNVHPVPPPNSEIEERIKKRYERKRTKIEKLLTLGYTTSGDPRKTGAK
Ga0193147_107090113300018747MarineDKLMKEVLNGGYNVHPVPAPNSEIKERIKKRYERKRNKIEKLLTLGYTTSGDPRKIGTK
Ga0193031_101380623300018765MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFTLGYTTSGDP
Ga0193031_104023523300018765MarineVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP
Ga0193031_104023813300018765MarineVLNGGYNVHPVPPPNSEIKEKITRRYERKRIKIEKLLTLGYTTSGEPXKIGAK
Ga0193212_102412913300018767MarineKEVLNGGYNVHPVPPPNSEIKERIAKKYERKRIKIERLLTLGYTTSGDP
Ga0193212_102413023300018767MarineKEVLNGGYNVHPVPPPNSEIEERIKKRYERKRTKIEKLLTLGYTTSGDPRKTGAK
Ga0193212_102546223300018767MarineGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP
Ga0193212_106615213300018767MarineMLAVETLIKEVLKGGYNVHPVPPPKSQMIERIIMRYERKRIKMEKLLILG
Ga0193478_103430523300018769MarineMKEVLNGGYIVHPVPDPNSDTKERISKKYERQRTKIEKLLTLGYTTSGEP
Ga0188848_100653823300018775Freshwater LakeMKEVLNGGYNVHPVPPPNSETKERSARKYERKRIKIEKLFTLGYTTSGDP
Ga0193472_103149313300018780MarineMKEVLNGGYNVHPVPPPKAEIKENITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0192950_107747313300018791MarineMKAVLEGDKLIKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP
Ga0193183_107730013300018811MarineKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0192872_107612513300018813MarineMRATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRTKIEKLFTL
Ga0193172_102300413300018820MarineKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDPXKIGAK
Ga0193253_109522413300018846MarineAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0193273_105817613300018850MarineVLNGGYNVHPVPPPNSEIEERIKRRYERKRTKIEKLLILGYTTSGDPXKIGAK
Ga0193475_106048613300018855MarineVLNGGYNVHPVPPPNSEMKEKIMKRYERKRIKIEKLFTLGYTTSGDPCKIGTK
Ga0193553_113659623300018873MarineYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDPRKTGAK
Ga0192955_1017373113300018930MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP
Ga0193552_1004846813300018934MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYESKRIKIERLLTLG
Ga0193552_1004847013300018934MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYESKRIIIERLLILGYTTSGDP
Ga0193552_1005347713300018934MarineGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP
Ga0193552_1005347813300018934MarineGGYNVHPVPPPNSEIKERIRRRYERKRIKMEKLLTLGYTTSGDP
Ga0193552_1005347913300018934MarineGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFILGYTTSGDP
Ga0193066_1020981713300018947MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIERLLTLGYTTSGDP
Ga0193066_1020982213300018947MarineVLEGDKLMKEVLNGGYNVHPVPPPNSETKERTTKTTERKRSKMEKLFTLGYTTSGDP
Ga0192961_1017719013300018980MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYT
Ga0192947_1022100013300018982MarineLMKEVLNGGYNVHPVPPPNSETKERIARRYERKRIKIEKLFTLGYTTSGDP
Ga0192947_1022676713300018982MarineVLNGGYNVHPVPPPNSEIEERTKKRYERKRIKIEKLLTLGYTTSGDPRKIGTK
Ga0192947_1022676813300018982MarineVLNGGYNVHPVPPPNSEIEERTKKRYERKRTKIEKLLTLGYTTSGDPRKIGTK
Ga0193017_1013160413300018983MarineMKEVLNGGYNVHPVPPPNSETRERTTRKYEREKTMIERLFSLGYTTSGDPXKIGTK
Ga0193017_1013160513300018983MarineMKEVLNGGYNVHPVPPPNSEIKERIMKRYEAKRTKIEKLLTLGYTTSGDPXKIGAK
Ga0193017_1013160613300018983MarineMKEVLNGGYNVHPVPPPNSEIKERIARRYERKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0193017_1013339413300018983MarineMKEVVNGGYNVQPTPAPNSEIKERMIRKYERKRSKIEKLFTLGYTTSGDPXKIGTK
Ga0193030_1006936823300018989MarineMKEVLNGGYNVHPVPHPNSDIKERIRKRYERXRIKIEKLLTLGYTISGEPXKIGTK
Ga0193030_1014325333300018989MarineTDKLMKEVLNGGYSVHPVPDPNSDIKESIRRKYERQRTKIEKLLTLG
Ga0193034_1016317013300019001MarinePKTMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRTKIEKLFTLGYTTSGDPCKIGTK
Ga0193154_1031180023300019006MarineMKEVLNGGYNVHPVPDPNSEIKERIRRKYERQRIKIEKLLTLGYTTSGEPXKIGTK
Ga0193516_1021917423300019031MarineMRATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRTKIEKLFT
Ga0192945_1001124533300019036MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0192945_1021685013300019036MarineVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDPXKITRR
Ga0192886_1020853713300019037MarineMKEVLNGGYNVHPVPPPNSEIEERIRKRYESKRIIIERLLILGYTTSGDPXKIGTK
Ga0193123_1039343913300019039MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYEGKRIKIEKLFILGYTTSGDPXKTGAK
Ga0192998_1028106613300019043MarineRKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKDRIRSRYERNRINIEKLLTLGYTTSGDP
Ga0193336_1047756323300019045MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERINIEKLFTLGYTTSPDPXKIGT
Ga0193546_1005703413300019046MarineVRPVPPPNSEITLIIAKRYERKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0193549_1004326713300019047MarineVLEGDKLMKEVLNGGYNVHPVPPPNSETKERSTRKYERKRTKIEKLFTLGYTTSGDP
Ga0193549_1004806713300019047MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRTKIERLFTLGYTTSGDP
Ga0193549_1005329313300019047MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRTKIERLFTLGYTTSGDPXKIGAK
Ga0193356_1023381513300019053MarineKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFILGYTTSGDPXKTGAK
Ga0193356_1025439313300019053MarineYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDPXKITTK
Ga0193356_1025969813300019053MarineYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFILGYTTSGDPXKTGAK
Ga0193040_101290213300019094MarineKEVLNGGYNVHPVPPPNSEIKERIMKRYETKRIKIEKLLTLGYTTSGDPXKIGTK
Ga0193045_105686423300019100MarineYNVHPVPPPNSEIKERITRRYERKRIKIEKLFTLGYTTSGDPXKIGTK
Ga0192946_101035813300019103MarineEVLNGGYNVHPVPPPNSEIEERTKRRYERKRTKIEKLLTLGYTTSGDPRKIGTK
Ga0192946_101036213300019103MarineEVLNGGYNVHPVPPPNSETKERIARRYERKRIKIEKLFTLGYTTSGDPXKTGAK
Ga0193054_106788113300019117MarineMKEVLNGGYNVHPVPPPNSEIKERIRRKYERKRIKIERLFTLGYTTSGDP
Ga0193157_103488313300019118MarineKEVLNGGYNVHPVPPPNSEIKERIRRRYEGKRIKIEKLFTLGYTTSGDP
Ga0193983_102960413300019749SedimentMKEVLNGGYNVHPVPPPNSEIKERIRKRYERNRIKIEKLLTLGYTTSGDPXKITTK
Ga0206128_105631013300020166SeawaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0194132_1011243813300020214Freshwater LakeGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0211708_1009958013300020436MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIE
Ga0211664_1013644423300020455MarinePVLEGDKLIKEVLNGGYNVHPLPPPNSVKIEKITKIYEIGIINIDKLFTLGYTTSGDPINIGTK
Ga0208852_107088223300020560FreshwaterMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGY
Ga0206679_1055294313300021089SeawaterMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLF
Ga0214162_104992213300021108FreshwaterVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDPXNITTK
Ga0214206_102441523300021131FreshwaterNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDPXKITTK
Ga0206687_115996123300021169SeawaterMKATLEGDKLMKEVLNGGYNVHPVPPPNSETREKIMRKYERK
Ga0210295_100505013300021323EstuarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP
Ga0206695_126885913300021348SeawaterAVLEGDKLIMEVLKGGYNVHPVPPPNSVHKESMTKRYETGRMRIDKLLTLGYTTSADPRKIGTK
Ga0206692_125072513300021350SeawaterMKEVLNGGYNVHPVPPPNSEIKERSAKKYERKKTKTEKLFTLGYTTSGDPXKIGAK
Ga0206692_147014813300021350SeawaterAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRKYESKRTKIEKLFTLGYTTSGDP
Ga0213861_1045022513300021378SeawaterAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0206685_1013374513300021442SeawaterMKEVLNGGYNVHPVPPPKSVMLERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0063105_104677713300021887MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEK
Ga0063139_104770413300021934MarineMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0063098_108806313300021942MarineIKEVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLLTLGYTTSGDP
Ga0222714_1061654913300021961Estuarine WaterNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDPXKIGTK
Ga0187827_1060450513300022227SeawaterPERKXSNGGYNVHPVPPPNSEMKERIMKKYERERIKIEKLFTLGYTTSEDPXKIGKK
Ga0222674_107113113300022848Saline WaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGKGKRSKGQER
Ga0222662_101711913300022885Saline WaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLG
Ga0222709_104455413300023230Saline WaterKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0232120_10368123300023555SeawaterMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP
Ga0232114_13335913300023676SeawaterLEGDKLMKEVLNGGYNVHPVPPPNSEIKERSAKRYERKRSKIEKLFTLGYTTSGDPXKIGIK
Ga0232119_102489913300023702SeawaterVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITRKYERQRTKIERLFFVLFQKLLC
(restricted) Ga0255040_1041162213300024059SeawaterPEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0228678_101904113300024244SeawaterMKAVLECDKLMKEVLNGGYNVHPVPPPNSEMKERITKRYETERIKIEKLFTLGYTTSGDP
Ga0228664_104054323300024294SeawaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0209833_109297413300025641Pelagic MarineMKAVLEGDKLIKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDP
Ga0209603_109066423300025849Pelagic MarineGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP
Ga0209955_102114423300026123WaterMKEVLNGGYNVHPVPPPNSEIKESIRKRYERERIKIEKLLTLGYTTSGDP
Ga0247573_105199533300026400SeawaterMKQVLNCVYKVHPVPPPKSEIKKRIRKRYERKRIKIEKLLTLRYTTP
Ga0247565_106289023300026406SeawaterMKEVLNGGYNVHPVPAPNSEIKERITKRYERKRIRIERLFTLGYTTSP
Ga0247570_109533713300026426SeawaterVLEGDKLMKEVLNGGYNVHPVPPPKSEVKERIRKRYERKRIKIEKLLTLGYTTSGDP
Ga0247577_101716823300026437SeawaterVVEGDKLMKEVLNGGYNVHPVPPPKSEIKERIRKRYERKRSKIEKLFTLGYTTSGDP
Ga0247604_111429723300026460SeawaterMKAILEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP
Ga0247603_113911613300026468SeawaterMKATLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0247592_114039513300026500SeawaterRKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERSAKRYERKRSKIEKLFTLGYTTSGDPXKIGIK
Ga0209892_101596523300026919SandVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLLTLGYTTSGDP
Ga0255581_105445623300027103CoralVDNGGRSVHPVPPPNSEIIERIRKRYESKRIKIEKLLTLGYTTSGDPXKIGTK
Ga0255581_113982923300027103CoralVDNGGKNVHPVPPPNSEIIERIRKRYESKRIKIEKLLTLGYTTSGDP
Ga0208797_103595513300027186EstuarineILGNQRLFPTLIKEVLNGGYNVHPVPPPNSENKERITKRYERERIKIEKLFTLGYTTSGD
Ga0208802_104988313300027210EstuarineMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDPXKIGTK
Ga0209077_113744113300027675Freshwater SedimentEGDKDMNEVDNGGYNVHPVPPPNSDIKERIRKRYEMKRIKIEKLLTLGYTTSGDP
Ga0209192_1008622113300027752MarineDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0209192_1022691113300027752MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKL
Ga0209770_1012414123300027769Freshwater LakeIRERVLEGDKDMKEVDNGGYNVHPVPPPNSEIKERIRKRYESKRIKIEKLLTLEYTTSGD
Ga0209279_1006912023300027771MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP
Ga0209279_1010742713300027771MarineLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0209229_1031968023300027805Freshwater And SedimentLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDPXKITTK
Ga0209230_1039879523300027836Freshwater And SedimentEGDKDMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDPXKIGT
Ga0209712_1060637123300027849MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRIKIEKLFTLGYTTSG
Ga0209503_1059248513300027859MarineGGYNVHPVPPPNSEIIERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
(restricted) Ga0233415_1001809613300027861SeawaterLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERKRIKIEKLLTLGYTTSGDP
Ga0209496_1060662413300027890WetlandMKLVLNGGYNVHPVPPPNSDIKESIRKRYERERIKIEKLLTLGYTTSGDP
Ga0255251_107308023300028088FreshwaterIIRPVLEGDKDMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDPXKIGAK
Ga0247596_112591423300028106SeawaterPVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDPXKTGAK
Ga0228621_108261913300028124SeawaterLIKEVLNGGYNVHPVPPPKSEIKERIRKRYERERIKIEKLLTLGYTTSGDPXKIGTK
Ga0265306_1067386913300028598SedimentMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEILFTLGYTTSGDPXKIGTK
Ga0307402_1020808713300030653MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0307401_1038903413300030670MarineAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLLTLGYTTSGDP
Ga0307403_1057238413300030671MarineVLEGDKLMKEVLNGGYNVHPVPPPNSETKERITKRYERKRIKIEKLFTLGYTTSGDP
Ga0307398_1069650313300030699MarineKLIKEVLKGGYNVHPVPPPNSVHKESITKRYEIGRMRIDKLLTLGYTTSADPRKIGTK
Ga0307400_1053241313300030709MarineVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDPXKIGTK
Ga0308133_104445723300030721MarineMKAILEGDKLIKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDP
Ga0308128_102186213300030725MarineMKEVLNGGYNVHPVPPPNSETKERSTRKYERKRIKIEKLFTLGYTTSGDPXKTGAK
Ga0073988_1001575313300030780MarineEGDKLMKEVLNGGYNVHPVPPPNSETKERTTRKYERKRTKMERLLTLGYTTSGDPXKIGA
Ga0073964_1002217123300030788MarineMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIERLLTL
Ga0151494_112294013300030871MarineMKEVLNGGYNVHPVPPPNSETKERSARKYERKRTKIEKLFTLGYTTSGDPXKTGAK
Ga0073944_1000434923300030956MarineMKEVLNGGYNVHPVPPPNSEIKERITKRYERKRTKIEKLFTLGYTTSGDPXKTGAK
Ga0073944_1143634823300030956MarineVLEGDKLMKEVLNGGYNVHPVPPPKSEIKEIIRRRYERKRTKIEKLLTLGYTTSGDP
Ga0307972_118858313300031222Saline WaterMKEVLNGGYNVHPVPPPNSEIKERITKRYERNRIKIEKLFTLGYTTSGDP
Ga0307380_1077348713300031539SoilMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRKRYERERIKIEKLFTLGYTTSGDP
Ga0307392_104809213300031550MarineMKEVLNGGYNVHPVPPPNSEIKERIKKRYERERIKIEKLFILGYTTSGDPXKIGAK
Ga0308142_104362323300031556MarineMKATLEGDKLMKEVLNGGYNVHPVPPPNSETKERIAKKYERKKSKIEKLFTLGYTTSGDPRKIRIK
Ga0308134_112702113300031579MarineKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLFILGYTTSGDPXKIGAK
Ga0302134_1024392013300031596MarineMKAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP
Ga0307386_1032796713300031710MarineKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDPXKITTK
Ga0307389_1049456813300031750MarineRFPVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLLILGYTTSGDP
Ga0335003_0432219_367_5553300033995FreshwaterKIIRPVLEGDKDMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDP
Ga0335005_0121889_1240_13713300034022FreshwaterMNEVDRGGYNVHPVPPPNSIIIDNIKIRYENKRINIEKLLTLG
Ga0334983_0695924_143_2953300034060FreshwaterMKEVDNGGYNVHPVPLPNSEIKERIRKRYERKRINIEKLLTLGYTTSGDP
Ga0315299_26114_73_2253300034481MarineMKEVLNGGYNVHPVPPPNSEIKERITRRYERKRIKIEKLFTLGYTTSGDP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.