Basic Information | |
---|---|
IMG/M Taxon OID | 3300008781 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117950 | Gp0126185 | Ga0103596 |
Sample Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron |
Sequencing Status | Permanent Draft |
Sequencing Center | Georgia Institute of Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 1565944 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine oxygen minimum zone → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010768 | Metagenome / Metatranscriptome | 299 | Y |
F065812 | Metagenome / Metatranscriptome | 127 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103596_10041 | Not Available | 1410 | Open in IMG/M |
Ga0103596_10569 | Not Available | 580 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103596_10041 | Ga0103596_100411 | F010768 | MKEVLNGGYNVHPVPPPNSETKERAARKYERKRSKTEKLFTLGYTTSGDPKKTGAK* |
Ga0103596_10569 | Ga0103596_105692 | F065812 | MQQERGGRRILRIKINGKKIADKDCEGKMKRTGKRGGKDLKSLRR |
⦗Top⦘ |