Sample 3300008781

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008781

3300008781: Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron

Overview

Basic Information
IMG/M Taxon OID	3300008781 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117950 \| Gp0126185 \| Ga0103596
Sample Name	Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron
Sequencing Status	Permanent Draft
Sequencing Center	Georgia Institute of Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1565944
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine oxygen minimum zone → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	North Pacific Ocean
Coordinates	Lat. (^o)	18.9	Long. (^o)	-104.5	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010768	Metagenome / Metatranscriptome	299	Y
F065812	Metagenome / Metatranscriptome	127	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103596_10041	Not Available	1410	Open in IMG/M
Ga0103596_10569	Not Available	580	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103596_10041	Ga0103596_100411	F010768	MKEVLNGGYNVHPVPPPNSETKERAARKYERKRSKTEKLFTLGYTTSGDPKKTGAK*
Ga0103596_10569	Ga0103596_105692	F065812	MQQERGGRRILRIKINGKKIADKDCEGKMKRTGKRGGKDLKSLRR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.